BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0993 (584 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 23 2.9 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 6.7 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 21 8.9 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 8.9 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 8.9 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 22.6 bits (46), Expect = 2.9 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = -1 Query: 161 ICCLGTPLPGPSTSARVWSITSTTLTNF 78 I CL P PG S ++ + L+N+ Sbjct: 5 ISCLVAPFPGASANSEAKRLYDDLLSNY 32 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.4 bits (43), Expect = 6.7 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +1 Query: 466 KCAPRRRPKNQLRSI 510 KC+ R+RP +Q S+ Sbjct: 880 KCSDRKRPASQATSV 894 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 21.0 bits (42), Expect = 8.9 Identities = 14/53 (26%), Positives = 23/53 (43%) Frame = -2 Query: 448 GIFFLPKVPARAAFTFKLLNTAVLARFLLTRAAVNLNLS*SVICARFSLFANF 290 GI L K P+R++ L ++L +V++ + RFS F F Sbjct: 543 GITILEKKPSRSSTLVSFLQPFSNTLWILVMVSVHVVALVLYLLDRFSPFGRF 595 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.0 bits (42), Expect = 8.9 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +2 Query: 197 SNTRSQPLLVL*GKRGQML 253 + T S+P+LVL G R ++L Sbjct: 273 AQTGSEPMLVLSGPRTRLL 291 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.0 bits (42), Expect = 8.9 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +2 Query: 197 SNTRSQPLLVL*GKRGQML 253 + T S+P+LVL G R ++L Sbjct: 273 AQTGSEPMLVLSGPRTRLL 291 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,695 Number of Sequences: 438 Number of extensions: 3284 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16993167 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -