BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0982 (747 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 24 1.7 AY340960-1|AAQ16586.1| 78|Apis mellifera apisimin precursor pr... 23 3.0 AY055108-1|AAL15544.1| 78|Apis mellifera apisimin precursor pr... 23 3.0 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 22 5.3 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 7.0 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 23.8 bits (49), Expect = 1.7 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -2 Query: 98 HVHFQATHHNQLQPKCMLNQHLDPSKPSQQQK 3 H H Q HH+ LQ + + H + QQQ+ Sbjct: 141 HHHLQ-NHHHHLQSTAVQDHHRPYQQQQQQQQ 171 >AY340960-1|AAQ16586.1| 78|Apis mellifera apisimin precursor protein. Length = 78 Score = 23.0 bits (47), Expect = 3.0 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -1 Query: 201 IAGRSRVPISSQLNFQNSESLSGSNL 124 + G S V + SQ+N S +SG+N+ Sbjct: 30 VKGESNVDVVSQINSLVSSIVSGANV 55 >AY055108-1|AAL15544.1| 78|Apis mellifera apisimin precursor protein. Length = 78 Score = 23.0 bits (47), Expect = 3.0 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -1 Query: 201 IAGRSRVPISSQLNFQNSESLSGSNL 124 + G S V + SQ+N S +SG+N+ Sbjct: 30 VKGESNVDVVSQINSLVSSIVSGANV 55 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 22.2 bits (45), Expect = 5.3 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = +3 Query: 585 KLGHTPAGIAVRQIAHYGQLINKNFLQTI*SRTLD 689 K HTP GI IAH L N L+ + R LD Sbjct: 791 KQSHTPNGIVKTWIAHDRYL--PNSLRILLKRFLD 823 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.8 bits (44), Expect = 7.0 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +3 Query: 243 IILVLTRNYCLLGYGIFE 296 +++VLTRN+ L + FE Sbjct: 1127 VLIVLTRNFLLTEWSRFE 1144 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 213,035 Number of Sequences: 438 Number of extensions: 4228 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23388480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -