BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0981 (545 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g35070.1 68417.m04978 expressed protein 27 6.2 At1g73810.1 68414.m08546 expressed protein contains Pfam profile... 27 8.2 >At4g35070.1 68417.m04978 expressed protein Length = 265 Score = 27.5 bits (58), Expect = 6.2 Identities = 12/46 (26%), Positives = 19/46 (41%) Frame = +2 Query: 320 CRGRGRFNFRHSPVQKLSTKRISLQCTDLGTLNLICPPVKHICICL 457 C G G N P +K+ C G ++ P +H+C C+ Sbjct: 197 CGGEGDGN--SLPAKKMKMSSCCCNCGSNGVTRVLFLPCRHLCCCM 240 >At1g73810.1 68414.m08546 expressed protein contains Pfam profile PF03267: Arabidopsis protein of unknown function, DUF266 Length = 418 Score = 27.1 bits (57), Expect = 8.2 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +2 Query: 296 VPVRDCPPCRGRGRFNFRHSPV 361 V V D P GRGR+N R SPV Sbjct: 262 VDVYDLPGPAGRGRYNRRMSPV 283 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,529,799 Number of Sequences: 28952 Number of extensions: 157464 Number of successful extensions: 342 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 338 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 342 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1023490624 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -