BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0978 (679 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33374| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_6487| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 >SB_33374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4475 Score = 29.5 bits (63), Expect = 2.6 Identities = 16/35 (45%), Positives = 21/35 (60%), Gaps = 2/35 (5%) Frame = +1 Query: 70 PNSQRILDIVISN--LFNEIGELLRAADPLRRDGY 168 P SQRIL +++ LFN+ L AA+ L R GY Sbjct: 3158 PGSQRILVVIMGGPQLFNQKRPLSTAAEQLHRHGY 3192 >SB_6487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 967 Score = 29.1 bits (62), Expect = 3.5 Identities = 14/49 (28%), Positives = 22/49 (44%) Frame = +1 Query: 148 PLRRDGYAGSWSPPGASDIINFSGRVTDVKADDFSSCICVVSATSAPDS 294 P+ GY G+ P G I F+G + + + C+ V +T P S Sbjct: 844 PIGPQGYNGTQGPKGDQGIQGFNGTKGESGVGNLTDCVFKVISTDVPVS 892 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,399,257 Number of Sequences: 59808 Number of extensions: 374315 Number of successful extensions: 1014 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 903 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1013 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1745338465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -