BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0976 (715 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8318| Best HMM Match : OTU (HMM E-Value=7.4e-19) 28 6.5 SB_2123| Best HMM Match : PKD_channel (HMM E-Value=0) 28 8.6 >SB_8318| Best HMM Match : OTU (HMM E-Value=7.4e-19) Length = 728 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -2 Query: 552 NRHILSPS*KLTTCVDRHPNPFICFKK 472 N+H PS K++ C++ H + IC K+ Sbjct: 376 NKHASCPSIKISKCIENHRHSRICSKQ 402 >SB_2123| Best HMM Match : PKD_channel (HMM E-Value=0) Length = 672 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = +2 Query: 416 KDISLLADFRIVSVSYLVYFLKQ-INGFG*RSTHVVSFHEGLNMCL 550 K +A+F IV V+ L+ F + FG RST SF + L CL Sbjct: 320 KSAKSIANFFIVFVAVLLAFTQLGFLAFGSRSTPYSSFFQSLRSCL 365 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,453,424 Number of Sequences: 59808 Number of extensions: 309816 Number of successful extensions: 387 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 353 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 384 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1889780269 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -