BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0973 (653 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_02_0095 + 6716327-6716335,6717302-6717451,6717523-6717583,671... 30 1.4 04_04_1042 - 30346132-30346285,30346629-30346759,30346867-303469... 29 4.3 01_06_1769 - 39774042-39774566,39775448-39775498,39776371-39776604 28 7.5 >02_02_0095 + 6716327-6716335,6717302-6717451,6717523-6717583, 6717646-6717725,6717802-6717903,6717982-6718471, 6718796-6719171,6720320-6720379,6720887-6721056, 6721287-6721340,6721384-6721523,6722362-6722511, 6722582-6722642,6722705-6722784,6722933-6723034, 6723111-6723612,6724401-6724776,6725419-6725493, 6726058-6726198,6726264-6726282 Length = 1065 Score = 30.3 bits (65), Expect = 1.4 Identities = 11/39 (28%), Positives = 25/39 (64%) Frame = -3 Query: 408 IYLLTINNCMHLWIYFMNSLKHYVFFCSDRQLNIIQYLF 292 ++ + +NC + + +S+KH VFFC+ R ++++ + F Sbjct: 532 VFFFSFSNCSICGLLYESSVKHIVFFCTIR-VDLVLHTF 569 >04_04_1042 - 30346132-30346285,30346629-30346759,30346867-30346938, 30347284-30347370,30347479-30347505,30347777-30347869, 30348470-30348558,30348649-30348727,30349102-30349231, 30349344-30349464,30349619-30349726,30349837-30350152 Length = 468 Score = 28.7 bits (61), Expect = 4.3 Identities = 16/52 (30%), Positives = 25/52 (48%) Frame = -3 Query: 540 SCWRFLFIP*TLLPIVSKPINIIRFHFPLSLHILLSINIYDNIKIYLLTINN 385 SC F + +LP++SK + +H L ILL + + YLL N+ Sbjct: 54 SCNLFQLVLFEILPVLSKHARFLNWHLDLFCLILLLVFVLPYYHCYLLLRNS 105 >01_06_1769 - 39774042-39774566,39775448-39775498,39776371-39776604 Length = 269 Score = 27.9 bits (59), Expect = 7.5 Identities = 7/32 (21%), Positives = 23/32 (71%) Frame = -3 Query: 402 LLTINNCMHLWIYFMNSLKHYVFFCSDRQLNI 307 LL + +++++ +N ++ YV++C D+++++ Sbjct: 79 LLKYDLYFYIFVHILNKVRGYVYYCPDKKVSL 110 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,463,999 Number of Sequences: 37544 Number of extensions: 173298 Number of successful extensions: 328 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 323 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 328 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1632177336 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -