BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0973 (653 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_10597| Best HMM Match : Gal-3-0_sulfotr (HMM E-Value=8.2e-34) 28 5.8 >SB_10597| Best HMM Match : Gal-3-0_sulfotr (HMM E-Value=8.2e-34) Length = 728 Score = 28.3 bits (60), Expect = 5.8 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -2 Query: 214 CVRIARYNLIHYFYYIPLYRTLIKCLQIMY 125 CV RY+L+ + YY+ L+RT K + Y Sbjct: 84 CVGNERYHLVSFRYYLSLFRTYKKNPKFSY 113 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,345,193 Number of Sequences: 59808 Number of extensions: 231397 Number of successful extensions: 375 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 348 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 375 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1669334250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -