BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0972 (509 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_11683| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_59562| Best HMM Match : RRM_1 (HMM E-Value=6.1e-23) 54 5e-08 SB_11682| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 7e-08 SB_41412| Best HMM Match : RRM_1 (HMM E-Value=2.9e-35) 37 0.011 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 36 0.019 SB_1585| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.026 SB_44114| Best HMM Match : RRM_1 (HMM E-Value=9.9e-35) 35 0.045 SB_971| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.078 SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.078 SB_41866| Best HMM Match : RRM_1 (HMM E-Value=0) 33 0.14 SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) 33 0.18 SB_51896| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_53070| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.55 SB_37198| Best HMM Match : RRM_1 (HMM E-Value=7.8e-23) 31 0.55 SB_2700| Best HMM Match : RRM_1 (HMM E-Value=0) 31 0.55 SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.96 SB_57434| Best HMM Match : LRR_1 (HMM E-Value=3.9e-13) 30 1.3 SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36) 30 1.3 SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0) 30 1.3 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_6474| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_44482| Best HMM Match : RRM_1 (HMM E-Value=0.19) 29 1.7 SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_11106| Best HMM Match : RRM_1 (HMM E-Value=1.8e-11) 29 2.2 SB_27005| Best HMM Match : NTF2 (HMM E-Value=1.1e-33) 29 2.9 SB_463| Best HMM Match : RRM_1 (HMM E-Value=3.3e-16) 29 2.9 SB_8823| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_5211| Best HMM Match : 7tm_1 (HMM E-Value=0.015) 28 5.1 SB_53804| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_28089| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_22052| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_4587| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 >SB_11683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 54.8 bits (126), Expect = 4e-08 Identities = 21/40 (52%), Positives = 29/40 (72%) Frame = +2 Query: 134 TRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPGFA 253 +RVY+G + + K ++EREF+ +G L VWVA NPPGFA Sbjct: 2 SRVYIGNIGDNASKREIEREFETFGPLRDVWVARNPPGFA 41 Score = 31.1 bits (67), Expect = 0.55 Identities = 13/37 (35%), Positives = 23/37 (62%) Frame = +1 Query: 241 PRFRFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 351 P F F FE+ ++AEDA ++G + G +VE+++ Sbjct: 38 PGFAFCVFEDRRDAEDAVRELDGRYICGQRARVELAK 74 >SB_59562| Best HMM Match : RRM_1 (HMM E-Value=6.1e-23) Length = 201 Score = 54.4 bits (125), Expect = 5e-08 Identities = 22/40 (55%), Positives = 29/40 (72%) Frame = +2 Query: 134 TRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPGFA 253 T++YVG L +LER F+K+G+L+ VWVA NPPGFA Sbjct: 4 TKLYVGNLGRNADSSELERAFEKFGRLSKVWVARNPPGFA 43 >SB_11682| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 54.0 bits (124), Expect = 7e-08 Identities = 22/40 (55%), Positives = 27/40 (67%) Frame = +2 Query: 134 TRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPGFA 253 T+VY+G L + K ++E EF YG L VWVA NPPGFA Sbjct: 32 TKVYIGSLGDNASKREIENEFGYYGPLKDVWVARNPPGFA 71 >SB_41412| Best HMM Match : RRM_1 (HMM E-Value=2.9e-35) Length = 1118 Score = 36.7 bits (81), Expect = 0.011 Identities = 17/35 (48%), Positives = 24/35 (68%) Frame = +1 Query: 247 FRFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 351 + F+EFE+ ++A+DA NG EMLG + VE SR Sbjct: 38 YGFVEFEDDRDADDAVYECNGKEMLGERILVEHSR 72 Score = 29.5 bits (63), Expect = 1.7 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +2 Query: 137 RVYVGGLVEGIKKEDLEREFDKYGKLNSV 223 RVY+G L G ++D+ R F YG+L + Sbjct: 4 RVYLGRLPYGTTEDDVRRFFRSYGRLRDI 32 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 35.9 bits (79), Expect = 0.019 Identities = 16/37 (43%), Positives = 23/37 (62%) Frame = +1 Query: 241 PRFRFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 351 P F F+EFE+ ++AEDA +G E G ++VE R Sbjct: 300 PPFAFVEFEDPRDAEDAVKGRDGHEFDGYRIRVEFPR 336 Score = 31.5 bits (68), Expect = 0.42 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +2 Query: 122 SSGGTRVYVGGLVEGIKKEDLEREFDKYGKLNSV 223 +S RVYVG L + ++++DL F KYG + V Sbjct: 257 NSNDCRVYVGNLPQDVREKDLHDIFYKYGHIADV 290 >SB_1585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 721 Score = 35.5 bits (78), Expect = 0.026 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +1 Query: 247 FRFIEFENLQEAEDACSAMNGTEMLGATLKVE 342 + +E+E +EA+ A A+NG EMLG + V+ Sbjct: 336 YALVEYETFKEAQSALEALNGAEMLGQNISVD 367 >SB_44114| Best HMM Match : RRM_1 (HMM E-Value=9.9e-35) Length = 929 Score = 34.7 bits (76), Expect = 0.045 Identities = 13/35 (37%), Positives = 25/35 (71%) Frame = +1 Query: 247 FRFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 351 + F+EF++ ++AEDA +NG +++G + VE S+ Sbjct: 724 YGFVEFDDHRDAEDAVHDLNGRDLIGERVVVEFSK 758 >SB_971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 783 Score = 33.9 bits (74), Expect = 0.078 Identities = 14/30 (46%), Positives = 21/30 (70%) Frame = +2 Query: 134 TRVYVGGLVEGIKKEDLEREFDKYGKLNSV 223 TR++VGGL I +LEREFD++G + + Sbjct: 318 TRLWVGGLGPWISIPELEREFDRFGAIRRI 347 >SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 33.9 bits (74), Expect = 0.078 Identities = 14/35 (40%), Positives = 23/35 (65%) Frame = +1 Query: 235 KSPRFRFIEFENLQEAEDACSAMNGTEMLGATLKV 339 +S F F+ F N ++A+ A ++NG E+ G TLK+ Sbjct: 97 RSRGFGFVTFANPEDAQTAVKSLNGKEVQGRTLKI 131 >SB_41866| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 718 Score = 33.1 bits (72), Expect = 0.14 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +1 Query: 235 KSPRFRFIEFENLQEAEDACSAMNGTEMLGATL 333 KS F F+ FE +EAE+A + +NG E+ G L Sbjct: 147 KSKGFGFVSFETPEEAEEAVNVLNGKEIGGRRL 179 >SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) Length = 1531 Score = 32.7 bits (71), Expect = 0.18 Identities = 12/28 (42%), Positives = 21/28 (75%) Frame = +2 Query: 140 VYVGGLVEGIKKEDLEREFDKYGKLNSV 223 ++VG L E I++ED+ + F +YG++ SV Sbjct: 8 LWVGNLPENIREEDIVKHFTRYGRVESV 35 Score = 30.3 bits (65), Expect = 0.96 Identities = 9/28 (32%), Positives = 19/28 (67%) Frame = +2 Query: 140 VYVGGLVEGIKKEDLEREFDKYGKLNSV 223 ++VGG+ + ++ +ER F +YG++ V Sbjct: 330 IWVGGVTNSLSEQQVERHFGRYGRVTKV 357 >SB_51896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 32.7 bits (71), Expect = 0.18 Identities = 16/32 (50%), Positives = 21/32 (65%) Frame = +2 Query: 119 MSSGGTRVYVGGLVEGIKKEDLEREFDKYGKL 214 M+S GT+++VG L + K DLE F YGKL Sbjct: 1 MASRGTQLFVGRLSKETKLRDLENVFYLYGKL 32 >SB_53070| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 347 Score = 31.1 bits (67), Expect = 0.55 Identities = 12/35 (34%), Positives = 22/35 (62%) Frame = +1 Query: 247 FRFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 351 F F+ ++N+ A++A MNG ++ LKV++ R Sbjct: 305 FGFVSYDNVMSAQNAIQHMNGFQIGAKRLKVQLKR 339 >SB_37198| Best HMM Match : RRM_1 (HMM E-Value=7.8e-23) Length = 362 Score = 31.1 bits (67), Expect = 0.55 Identities = 12/35 (34%), Positives = 22/35 (62%) Frame = +1 Query: 247 FRFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 351 F F+ ++N+ A++A MNG ++ LKV++ R Sbjct: 320 FGFVSYDNVMSAQNAIQHMNGFQIGAKRLKVQLKR 354 >SB_2700| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 593 Score = 31.1 bits (67), Expect = 0.55 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = +1 Query: 235 KSPRFRFIEFENLQEAEDACSAMNGTEMLGATLKV 339 K + FIE+EN Q A DA ++MN ++ G L+V Sbjct: 238 KHKGYGFIEYENQQSANDAIASMNLFDLGGQFLRV 272 >SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 389 Score = 30.3 bits (65), Expect = 0.96 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +1 Query: 247 FRFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 351 + F+ ++N +A A MNG + TLKV +R Sbjct: 70 YAFVNYDNPDDANKAVREMNGARLQNKTLKVSFAR 104 >SB_57434| Best HMM Match : LRR_1 (HMM E-Value=3.9e-13) Length = 337 Score = 29.9 bits (64), Expect = 1.3 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = +2 Query: 140 VYVGGLVEGIKKEDLEREFDKYGKLNSV 223 V+VG L +KK+ L++ F KYG++ SV Sbjct: 23 VFVGNLPLTLKKKALKKYFSKYGEVESV 50 >SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36) Length = 328 Score = 29.9 bits (64), Expect = 1.3 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 5/44 (11%) Frame = +2 Query: 137 RVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALN-----PPGFA 253 +++VGGL KE L+ F KYG+L V + ++ P GFA Sbjct: 30 KLFVGGLSYETTKESLKEYFSKYGELVGVDIKMDALTGRPRGFA 73 >SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 514 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +1 Query: 229 STKSPRFRFIEFENLQEAEDACSAMNGTEMLGATLKV 339 + +S + F++F + A+ A MNG E+ G LK+ Sbjct: 279 TNRSKGYGFVQFREAEAAKRAMEQMNGFELAGRPLKI 315 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +2 Query: 134 TRVYVGGLVEGIKKEDLEREFDKYGKLNSV 223 T +YVGGL + ++DL F ++G+L S+ Sbjct: 304 TTLYVGGLEGKVTEQDLRDHFYQFGELRSI 333 >SB_6474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +2 Query: 122 SSGGTRVYVGGLVEGIKKEDLEREFDKYG 208 S+ +V++GGL G +EDL+ F YG Sbjct: 198 SANDGKVFIGGLAFGTTEEDLKEYFSTYG 226 >SB_44482| Best HMM Match : RRM_1 (HMM E-Value=0.19) Length = 486 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +2 Query: 140 VYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPG 247 VYVG + + K+D+ R F KYG + V V G Sbjct: 372 VYVGKISDETHKDDVWRRFRKYGPIEKVTVHFRDNG 407 >SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 29.5 bits (63), Expect = 1.7 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +2 Query: 140 VYVGGLVEGIKKEDLEREFDKYGKLNSVWV 229 VYVG L + DL + F++YGK+ V + Sbjct: 12 VYVGNLPYSLTNSDLHKVFERYGKVVKVTI 41 >SB_11106| Best HMM Match : RRM_1 (HMM E-Value=1.8e-11) Length = 67 Score = 29.1 bits (62), Expect = 2.2 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +1 Query: 247 FRFIEFENLQEAEDACSAMNGTEMLG 324 + F+EF+ +AEDA NG +MLG Sbjct: 40 YGFVEFDYSDDAEDAVYECNGKKMLG 65 >SB_27005| Best HMM Match : NTF2 (HMM E-Value=1.1e-33) Length = 662 Score = 28.7 bits (61), Expect = 2.9 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 137 RVYVGGLVEGIKKEDLEREFDKYGKL 214 +V++G L G+K D+ F KYG + Sbjct: 358 QVFIGNLPSGVKDADVNEVFSKYGTI 383 >SB_463| Best HMM Match : RRM_1 (HMM E-Value=3.3e-16) Length = 842 Score = 28.7 bits (61), Expect = 2.9 Identities = 8/27 (29%), Positives = 20/27 (74%) Frame = +2 Query: 137 RVYVGGLVEGIKKEDLEREFDKYGKLN 217 ++++GGL +ED+++ F ++GK++ Sbjct: 184 KIFIGGLSTNTSEEDMKKYFSQFGKVS 210 >SB_8823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1309 Score = 27.9 bits (59), Expect = 5.1 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +2 Query: 134 TRVYVGGLVEGIKKEDLEREFDKYGKL 214 T VYVG L +K +L++ F +YG + Sbjct: 615 TTVYVGNLPPDVKDYELQQMFSQYGSI 641 >SB_5211| Best HMM Match : 7tm_1 (HMM E-Value=0.015) Length = 728 Score = 27.9 bits (59), Expect = 5.1 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = +2 Query: 377 GSEVGAAVTSGVVVHSEVREEAGSTTHTVAAAAGR 481 G VGA++TS V +RE+ G+TT+TV G+ Sbjct: 163 GVFVGASMTSVV---QRIREDLGATTYTVTCQYGK 194 >SB_53804| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 27.5 bits (58), Expect = 6.8 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = -2 Query: 319 TSQYHSSRYTHLPPPASS 266 T++YH ++T LPPP+ S Sbjct: 169 TTEYHPEQHTPLPPPSKS 186 >SB_28089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 254 Score = 27.5 bits (58), Expect = 6.8 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +2 Query: 125 SGGTRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVAL 235 S TRVY G L ++ DLE+ YG++ + + L Sbjct: 2 SRSTRVYFGRLPRDCRERDLEKFVRGYGRVREISMKL 38 Score = 27.5 bits (58), Expect = 6.8 Identities = 9/26 (34%), Positives = 18/26 (69%) Frame = +1 Query: 247 FRFIEFENLQEAEDACSAMNGTEMLG 324 + F+EF++ ++A+D +NG +LG Sbjct: 40 YGFVEFDDYRDADDCVYDLNGRNLLG 65 >SB_22052| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 27.5 bits (58), Expect = 6.8 Identities = 13/36 (36%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = +1 Query: 250 RFIEFENLQEAEDACSAMNGTEM-LGATLKVEISRK 354 RF+ F + +EAE A +G ++ G L+V++S+K Sbjct: 146 RFVGFSSYREAEHAIRKFDGFDLGQGLRLRVQLSKK 181 >SB_4587| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2656 Score = 27.5 bits (58), Expect = 6.8 Identities = 13/36 (36%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = +1 Query: 250 RFIEFENLQEAEDACSAMNGTEM-LGATLKVEISRK 354 RF+ F + +EAE A +G ++ G L+V++S+K Sbjct: 46 RFVGFSSYREAEHAIRKFDGFDLGQGLRLRVQLSKK 81 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,892,941 Number of Sequences: 59808 Number of extensions: 217470 Number of successful extensions: 609 Number of sequences better than 10.0: 32 Number of HSP's better than 10.0 without gapping: 557 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 609 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1123894172 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -