BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0969 (687 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A7QXI3 Cluster: Chromosome undetermined scaffold_225, w... 36 1.2 UniRef50_A2FU42 Cluster: Putative uncharacterized protein; n=1; ... 34 3.7 >UniRef50_A7QXI3 Cluster: Chromosome undetermined scaffold_225, whole genome shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome undetermined scaffold_225, whole genome shotgun sequence - Vitis vinifera (Grape) Length = 751 Score = 35.5 bits (78), Expect = 1.2 Identities = 16/60 (26%), Positives = 31/60 (51%) Frame = +2 Query: 503 KQQILDVINNITRMPILCDGPKEDMEPLLLPLLAYIAERKNDYSIDLSSCDLVKYECLVT 682 K ++ ++ + + R + D PKED P P+ Y+ RKN + L + K +C+++ Sbjct: 243 KVELFEINSKLQRPELHDDRPKEDRSPSPEPVYDYLGNRKNTREVRLREKLIKKRQCIIS 302 >UniRef50_A2FU42 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 731 Score = 33.9 bits (74), Expect = 3.7 Identities = 21/63 (33%), Positives = 34/63 (53%) Frame = +2 Query: 476 VQILQRTINKQQILDVINNITRMPILCDGPKEDMEPLLLPLLAYIAERKNDYSIDLSSCD 655 + ++ +T N +I+ VI +T +L ED+E LL LA IA+ ND D+S + Sbjct: 281 IDLIMKTPNPAEIVPVITGLTHRTVLF--LHEDIEMLLF--LAKIAKNNNDMQFDISLSE 336 Query: 656 LVK 664 +K Sbjct: 337 NIK 339 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 569,048,031 Number of Sequences: 1657284 Number of extensions: 9967432 Number of successful extensions: 19126 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 18648 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19123 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 53719013270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -