BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0969 (687 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1751.03 ||SPAC31A2.01|translation initiation factor eIF3m|Sc... 32 0.089 SPCC1494.05c |ubp12||ubiquitin C-terminal hydrolase Ubp12|Schizo... 26 4.4 >SPAC1751.03 ||SPAC31A2.01|translation initiation factor eIF3m|Schizosaccharomyces pombe|chr 1|||Manual Length = 402 Score = 31.9 bits (69), Expect = 0.089 Identities = 15/64 (23%), Positives = 36/64 (56%), Gaps = 1/64 (1%) Frame = +2 Query: 428 LGMHFVLLQNSSTLYPVQILQRTINKQQILDVINN-ITRMPILCDGPKEDMEPLLLPLLA 604 L M+ L+ ++ + + + + + + +V+N +TR+P+L P++++EP+L + Sbjct: 21 LAMYLDNLEANTDKNVLALCREYLASENVKEVLNLFLTRLPLLAQAPEKELEPILAVFIN 80 Query: 605 YIAE 616 I E Sbjct: 81 LIQE 84 >SPCC1494.05c |ubp12||ubiquitin C-terminal hydrolase Ubp12|Schizosaccharomyces pombe|chr 3|||Manual Length = 979 Score = 26.2 bits (55), Expect = 4.4 Identities = 10/33 (30%), Positives = 22/33 (66%) Frame = +2 Query: 530 NITRMPILCDGPKEDMEPLLLPLLAYIAERKND 628 +++ +P+L + K+D+E + PL A+ E ++D Sbjct: 708 SVSNLPLLTERDKKDLESTVDPLDAHSIEEEDD 740 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,519,998 Number of Sequences: 5004 Number of extensions: 47485 Number of successful extensions: 105 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 104 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 105 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 317927284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -