BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0969 (687 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. 24 5.2 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 23 9.0 >AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. Length = 1229 Score = 23.8 bits (49), Expect = 5.2 Identities = 10/30 (33%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = -3 Query: 190 KTSFECHSQIRDAMCPF-VEILALSINLFD 104 K F CH+ + +CP+ E L +FD Sbjct: 1189 KEEFYCHADVLIGICPYPAECLVSQTLIFD 1218 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 23.0 bits (47), Expect = 9.0 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = -1 Query: 534 MLLITSSICCLLMVL*RICTGYNVEEFCNNTKCMP 430 ++L+T++I +L ++ I +V C+ +KC P Sbjct: 18 LVLVTATILPILSLMVPIGHSQSVITDCDTSKCQP 52 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 635,322 Number of Sequences: 2352 Number of extensions: 11797 Number of successful extensions: 24 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -