BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0967 (649 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g61600.1 68414.m06941 expressed protein 30 1.5 At5g25170.1 68418.m02984 expressed protein 29 2.7 At1g11220.1 68414.m01285 expressed protein contains similarity t... 29 2.7 At4g16080.1 68417.m02438 hypothetical protein contains Pfam prof... 29 3.5 At5g25830.1 68418.m03065 zinc finger (GATA type) family protein ... 28 6.1 At1g18640.2 68414.m02324 3-phosphoserine phosphatase (PSP) nearl... 27 8.1 At1g18640.1 68414.m02323 3-phosphoserine phosphatase (PSP) nearl... 27 8.1 >At1g61600.1 68414.m06941 expressed protein Length = 421 Score = 29.9 bits (64), Expect = 1.5 Identities = 27/104 (25%), Positives = 46/104 (44%), Gaps = 3/104 (2%) Frame = +3 Query: 180 RQGCEHRTSNTCHPLRPKHPAGCYYQQGVVIPQGIFVDLLGWGTTVQGGSVSDGNLHKLE 359 ++G E RTS + HP RP+ G + +P F +T++ GSV G + Sbjct: 172 KKGWELRTSRSLHPRRPREALGLDEELRARLPAFGFP-----VSTIRSGSVIVGEWYCPF 226 Query: 360 LIVTNKENC---REQYKGHDRVVTDNKFCAGLVRAGGRDYDNTD 482 + V KENC ++ K +T +++ + G D D + Sbjct: 227 MFV--KENCSVSQQMRKSMFYRITLSQYWERIYHCGNNDLDENN 268 >At5g25170.1 68418.m02984 expressed protein Length = 218 Score = 29.1 bits (62), Expect = 2.7 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +2 Query: 428 QILRRFGPGWWPRLRQY*LGCPCLLPKAL 514 Q+ RR P W RL ++ L C C+LP L Sbjct: 127 QLTRRSIPSWVNRLARFGLFCNCVLPAEL 155 >At1g11220.1 68414.m01285 expressed protein contains similarity to cotton fiber expressed protein 1 [Gossypium hirsutum] gi|3264828|gb|AAC33276 Length = 310 Score = 29.1 bits (62), Expect = 2.7 Identities = 14/43 (32%), Positives = 25/43 (58%) Frame = +1 Query: 406 MIAS*LITNSAPVWSGLVAATTTILTWVPLPSSKSASRHRIFW 534 M++S + +A + +G+VA + + + VP+ S SR IFW Sbjct: 1 MVSSMISIKAALITAGIVAVSLFLKSSVPIAVDFSVSRFPIFW 43 >At4g16080.1 68417.m02438 hypothetical protein contains Pfam profile PF03478: Protein of unknown function (DUF295) Length = 379 Score = 28.7 bits (61), Expect = 3.5 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -1 Query: 403 PLYCSLQFSLLVTMSSSLWRLPSDTL 326 P Y L FS+LVT +SLW L D + Sbjct: 212 PQYHELNFSILVTGHTSLWSLLQDNV 237 >At5g25830.1 68418.m03065 zinc finger (GATA type) family protein GATA transcription factor, Arabidopsis thaliana, PIR:T05288 Length = 331 Score = 27.9 bits (59), Expect = 6.1 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +3 Query: 243 GCYYQQGVVIPQGIFVDLLGWGTTVQGGSVSDGNLHKLELI 365 G + + IP D L W + + S+S ++HKLELI Sbjct: 64 GTSFSGDLCIPSDDLADELEWLSNIVDESLSPEDVHKLELI 104 >At1g18640.2 68414.m02324 3-phosphoserine phosphatase (PSP) nearly identical to 3-phosphoserine phosphatase GI:3759177 from [Arabidopsis thaliana] Length = 295 Score = 27.5 bits (58), Expect = 8.1 Identities = 8/28 (28%), Positives = 18/28 (64%) Frame = -2 Query: 264 HLVDNSTLLDVWAEVDGMCYSYDAHILV 181 ++V + +LD+W V+ +C+ D+ + V Sbjct: 69 NIVPSKEILDLWRSVEAVCFDVDSTVCV 96 >At1g18640.1 68414.m02323 3-phosphoserine phosphatase (PSP) nearly identical to 3-phosphoserine phosphatase GI:3759177 from [Arabidopsis thaliana] Length = 295 Score = 27.5 bits (58), Expect = 8.1 Identities = 8/28 (28%), Positives = 18/28 (64%) Frame = -2 Query: 264 HLVDNSTLLDVWAEVDGMCYSYDAHILV 181 ++V + +LD+W V+ +C+ D+ + V Sbjct: 69 NIVPSKEILDLWRSVEAVCFDVDSTVCV 96 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,426,503 Number of Sequences: 28952 Number of extensions: 351184 Number of successful extensions: 946 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 918 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 946 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1344285648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -