BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0964 (681 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 27 0.17 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 27 0.22 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 24 1.5 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 22 4.7 DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 21 8.2 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 27.1 bits (57), Expect = 0.17 Identities = 14/54 (25%), Positives = 28/54 (51%) Frame = -1 Query: 483 SNGSNVSNLDRLGDGAIDNNHGLSNDFGFVNDNHGLRDNGIDTGSGDNRGRASL 322 SN S ++ + + + +NN+ +N+ N+N+G DNG G+ +N + Sbjct: 223 SNNSTITAGNANTNASNNNNNNNNNN----NNNNGANDNGNGNGASNNNNNGDM 272 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 26.6 bits (56), Expect = 0.22 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 3/48 (6%) Frame = -1 Query: 474 SNVSNLDRLGDGAIDNNHGLSNDFGF---VNDNHGLRDNGIDTGSGDN 340 S++ D+L D I LS D VN +HG++ +G + GD+ Sbjct: 664 SSIKASDKLKDSRIKTTEKLSTDPNTHFQVNQSHGIKRSGSHSWEGDS 711 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = -1 Query: 435 IDNNHGLSNDFGFVNDNHGLRDNGIDT 355 I NN+ LSN++ + N+N+ +N +T Sbjct: 82 ISNNNSLSNNYNY-NNNYNNYNNNYNT 107 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 22.2 bits (45), Expect = 4.7 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +3 Query: 123 RTCHHR*VRAHFRRTCH 173 R HH AH RRT H Sbjct: 149 RCLHHDIENAHIRRTLH 165 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 21.4 bits (43), Expect = 8.2 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -2 Query: 143 SSMMAGPTAIGTKSSMM 93 +S +AG AIGT + MM Sbjct: 275 NSTLAGGVAIGTAAGMM 291 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,975 Number of Sequences: 438 Number of extensions: 3219 Number of successful extensions: 20 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20708550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -