BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0964 (681 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g43530.1 68416.m04621 hypothetical protein contains Pfam prof... 36 0.025 At3g18810.1 68416.m02389 protein kinase family protein contains ... 33 0.23 At5g62940.1 68418.m07897 Dof-type zinc finger domain-containing ... 31 0.71 At1g73150.1 68414.m08460 DNA-binding bromodomain-containing prot... 30 1.2 At4g19130.1 68417.m02823 replication protein-related similar to ... 30 1.6 At5g11530.1 68418.m01345 embryonic flower 1 (EMF1) identical to ... 29 2.8 At2g38010.1 68415.m04665 ceramidase family protein contains Pfam... 29 2.8 At2g36270.1 68415.m04452 bZIP transcription factor family protei... 29 2.8 At3g48470.1 68416.m05291 expressed protein 29 3.8 At1g72390.1 68414.m08373 expressed protein 29 3.8 At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin fa... 28 5.0 At4g01050.1 68417.m00142 hydroxyproline-rich glycoprotein family... 28 5.0 At2g21060.1 68415.m02500 cold-shock DNA-binding family protein /... 28 5.0 >At3g43530.1 68416.m04621 hypothetical protein contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287 Length = 615 Score = 35.9 bits (79), Expect = 0.025 Identities = 25/90 (27%), Positives = 38/90 (42%) Frame = -1 Query: 357 TGSGDNRGRASLVDVQNDLHERSAVSNGGKRRVVSIAGPTEIGTLSSTMAGPTEIGSNSC 178 TG+ D G + D +N+L E S + G R V TEI + E+G Sbjct: 411 TGTDDAYGSKEIDDRENELEEGSDANGGDNEREVR-EKETEIDKEVAQGDNEREVGEKET 469 Query: 177 DNGRSDGSGLELIYDGRSDSDRYKVVDDGS 88 + + G G I+DG D + K V + + Sbjct: 470 EIDKEVGQGDSDIFDGNKDMELNKEVAEST 499 >At3g18810.1 68416.m02389 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 700 Score = 32.7 bits (71), Expect = 0.23 Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 1/60 (1%) Frame = -1 Query: 480 NGSNVSNLDRLGDGAIDNNHGLSNDFGFV-NDNHGLRDNGIDTGSGDNRGRASLVDVQND 304 N +N +N + G+ DNN+G + D N+N+G +NG D +N G + + QN+ Sbjct: 79 NNNNDNNNNNNGNNNNDNNNGNNKDNNNNGNNNNGNNNNGNDNNGNNNNGNNNDNNNQNN 138 >At5g62940.1 68418.m07897 Dof-type zinc finger domain-containing protein Dof zinc finger protein, Oryza sativa, EMBL:AB028129 Length = 372 Score = 31.1 bits (67), Expect = 0.71 Identities = 23/64 (35%), Positives = 32/64 (50%), Gaps = 4/64 (6%) Frame = -1 Query: 492 LLGSNGSNVS--NLDRLGDGAIDNNH--GLSNDFGFVNDNHGLRDNGIDTGSGDNRGRAS 325 L+G N N+ N GD +NH GL++ G N+N+ NGI TG N G Sbjct: 216 LMGVNNDNLVMVNHGSNGDHHHHHNHHMGLNHGVGLNNNNNNGGFNGISTGGNGNGG--G 273 Query: 324 LVDV 313 L+D+ Sbjct: 274 LMDI 277 >At1g73150.1 68414.m08460 DNA-binding bromodomain-containing protein contains bromodomain, INTERPRO:IPR001487 Length = 461 Score = 30.3 bits (65), Expect = 1.2 Identities = 17/53 (32%), Positives = 27/53 (50%) Frame = -1 Query: 309 NDLHERSAVSNGGKRRVVSIAGPTEIGTLSSTMAGPTEIGSNSCDNGRSDGSG 151 N +HE + + G + V TE+G ++ST+ +G +S N S GSG Sbjct: 395 NSVHESNTLVTGLESSKV-----TELGHVASTVRQEVNVGGSSSSNSSSSGSG 442 >At4g19130.1 68417.m02823 replication protein-related similar to replication protein A 70kDa [Oryza sativa] GI:13536993; contains Pfam profile PF00098: Zinc knuckle Length = 461 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/45 (40%), Positives = 22/45 (48%) Frame = -2 Query: 611 FRLRAPESGHGGHVDIDRYSVKGLRKSDSGCGNDGVATITCLGAT 477 F L A +SG G+ YS G S + CGN G + C GAT Sbjct: 389 FGLHAHQSGQSGN----HYSGGGATTSCNVCGNSGHVSAKCPGAT 429 >At5g11530.1 68418.m01345 embryonic flower 1 (EMF1) identical to embryonic flower 1 [Arabidopsis thaliana] GI:15430697 Length = 1096 Score = 29.1 bits (62), Expect = 2.8 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 5/52 (9%) Frame = -1 Query: 234 IGTLSSTMAGPTEIGSNSCD----NGRSDGSGLELI-YDGRSDSDRYKVVDD 94 + + STM +E S SCD N S SG + + G+ + R++VVD+ Sbjct: 307 VSRILSTMGATSENASKSCDSDQGNSESTDSGFDRTPFKGKQRNRRFQVVDE 358 >At2g38010.1 68415.m04665 ceramidase family protein contains Pfam domain, PF04734: Neutral/alkaline nonlysosomal ceramidase Length = 757 Score = 29.1 bits (62), Expect = 2.8 Identities = 27/91 (29%), Positives = 37/91 (40%), Gaps = 1/91 (1%) Frame = -1 Query: 396 VNDNHGLRDNGIDTGSGDNRGRASLVDVQNDLHERSAVSNGGKRRVVSIAGPTEIGTLSS 217 V+D RD +D + R VD D+ R V NG KR+ VS + G +S Sbjct: 274 VSDFSRNRDRLLDIAATYKSSRGHSVDKSLDVKTR--VRNGSKRKFVSAFCQSNCGDVSP 331 Query: 216 TMAGPTEIGSN-SCDNGRSDGSGLELIYDGR 127 G I + CD S +G + GR Sbjct: 332 NTLGTFCIDTGLPCDFNHSTCNGQNELCYGR 362 >At2g36270.1 68415.m04452 bZIP transcription factor family protein / ABA-responsive element-binding protein, putative similar to ABA-responsive element binding protein 1 (AREB1) GI:9967417 from [Arabidopsis thaliana]; contains a bZIP transcription factor basic domain signature (PDOC00036) Length = 442 Score = 29.1 bits (62), Expect = 2.8 Identities = 27/117 (23%), Positives = 46/117 (39%), Gaps = 1/117 (0%) Frame = -1 Query: 501 DDHLLGSNGSNVSNLDRLGDGAIDNNHGL-SNDFGFVNDNHGLRDNGIDTGSGDNRGRAS 325 D+ L+ + +N ++ A +H + +N GF N+N+ + G+ SG +RG Sbjct: 68 DEFLVSIWNAEENNNNQQQAAAAAGSHSVPANHNGFNNNNNNGGEGGVGVFSGGSRGNED 127 Query: 324 LVDVQNDLHERSAVSNGGKRRVVSIAGPTEIGTLSSTMAGPTEIGSNSCDNGRSDGS 154 + + +E S G + T S G G+ NGRS S Sbjct: 128 ANNKRGIANESSLPRQGSLTLPAPLCRKTVDEVWSEIHRGGGS-GNGGDSNGRSSSS 183 >At3g48470.1 68416.m05291 expressed protein Length = 1017 Score = 28.7 bits (61), Expect = 3.8 Identities = 23/75 (30%), Positives = 37/75 (49%), Gaps = 3/75 (4%) Frame = -1 Query: 369 NGIDTGSGDNRGRASLVDVQNDLHERSAVSNGGKRRVVS---IAGPTEIGTLSSTMAGPT 199 N ++ G G+N+ ASL +V N+ R+ K + +S +A P EI L +T+ T Sbjct: 524 NTMENGDGENKRSASLTEV-NESSRRNKQKENRKSKNISAFVLADPNEIVDL-ATLNCDT 581 Query: 198 EIGSNSCDNGRSDGS 154 E + D+ S S Sbjct: 582 ESDKDDGDDDASVSS 596 >At1g72390.1 68414.m08373 expressed protein Length = 1088 Score = 28.7 bits (61), Expect = 3.8 Identities = 15/46 (32%), Positives = 25/46 (54%) Frame = +1 Query: 451 PVQVADITPVAPKQVIVATPSFPHPLSLFLRPLTEYRSMSTCPP*P 588 P Q++ TP++P+QV TP P S + P++ ++ CP P Sbjct: 1012 PQQMSQRTPMSPQQVNQRTPMSPQISSGAMHPMST-SNLEGCPASP 1056 >At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin family protein contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 401 Score = 28.3 bits (60), Expect = 5.0 Identities = 18/51 (35%), Positives = 21/51 (41%) Frame = +1 Query: 439 PVPEPVQVADITPVAPKQVIVATPSFPHPLSLFLRPLTEYRSMSTCPP*PL 591 P+P + PV P IV PS P P F PL + PP PL Sbjct: 326 PIPT-IPTLPPLPVLPPVPIVNPPSLPPPPPSFPVPLPPVPGLPGIPPVPL 375 >At4g01050.1 68417.m00142 hydroxyproline-rich glycoprotein family protein Length = 466 Score = 28.3 bits (60), Expect = 5.0 Identities = 21/51 (41%), Positives = 23/51 (45%), Gaps = 3/51 (5%) Frame = +1 Query: 439 PVPEPVQVADITPVAPKQVI---VATPSFPHPLSLFLRPLTEYRSMSTCPP 582 PVPEPV V I QVI T + P P S RPL+ Y S P Sbjct: 410 PVPEPVPVPAIEAAVAAQVITEPTETEAKPKPHS---RPLSPYASYPDLKP 457 >At2g21060.1 68415.m02500 cold-shock DNA-binding family protein / glycine-rich protein (GRP2) identical to Glycine-rich protein 2b (AtGRP2b) [Arabidopsis thaliana] SWISS-PROT:Q38896; contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 201 Score = 28.3 bits (60), Expect = 5.0 Identities = 19/85 (22%), Positives = 33/85 (38%) Frame = -1 Query: 405 FGFVNDNHGLRDNGIDTGSGDNRGRASLVDVQNDLHERSAVSNGGKRRVVSIAGPTEIGT 226 FGF+ + G D + S + G SL + + V N G+ + + ++GP Sbjct: 28 FGFITPSDGGDDLFVHQSSIRSEGFRSLA-AEESVEFDVEVDNSGRPKAIEVSGPDGAPV 86 Query: 225 LSSTMAGPTEIGSNSCDNGRSDGSG 151 ++ G + G G G G Sbjct: 87 QGNSGGGGSSGGRGGFGGGGGRGGG 111 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,193,815 Number of Sequences: 28952 Number of extensions: 245798 Number of successful extensions: 862 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 811 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 853 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1438152744 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -