BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0963 (704 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 21 7.4 DQ855488-1|ABH88175.1| 112|Tribolium castaneum chemosensory pro... 21 7.4 AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like prote... 21 9.8 AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain tran... 21 9.8 AF231104-1|AAF64149.1| 142|Tribolium castaneum labial protein p... 21 9.8 AF231103-1|AAF64148.1| 142|Tribolium castaneum labial protein p... 21 9.8 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 21.4 bits (43), Expect = 7.4 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -1 Query: 308 PVNKL*EMLSNSKVLKPAR*HLLR 237 P+N EML +K+LK R +L++ Sbjct: 384 PLNISREMLQQNKILKVIRKNLVK 407 >DQ855488-1|ABH88175.1| 112|Tribolium castaneum chemosensory protein 1 protein. Length = 112 Score = 21.4 bits (43), Expect = 7.4 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = +2 Query: 341 LRPQ*TLLKEKSKFSTVN*PQTLLEESPCPT 433 ++PQ T + +++ ST+N + LL + C T Sbjct: 23 VKPQLTRISDEAIESTLNDRRYLLRQLKCAT 53 >AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like protein protein. Length = 314 Score = 21.0 bits (42), Expect = 9.8 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -1 Query: 563 SDLTPEQVQLDFRVDF 516 +DLTPEQ+Q DF Sbjct: 222 TDLTPEQIQAAEVKDF 237 >AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain transcription factor Labialprotein. Length = 353 Score = 21.0 bits (42), Expect = 9.8 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -1 Query: 419 IPPEASAVSLRSKIWTSPSAASI 351 IPPE + SL + SPS+ ++ Sbjct: 317 IPPEPISASLSTSNSNSPSSTNL 339 >AF231104-1|AAF64149.1| 142|Tribolium castaneum labial protein protein. Length = 142 Score = 21.0 bits (42), Expect = 9.8 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -1 Query: 419 IPPEASAVSLRSKIWTSPSAASI 351 IPPE + SL + SPS+ ++ Sbjct: 106 IPPEPISASLSTSNSNSPSSTNL 128 >AF231103-1|AAF64148.1| 142|Tribolium castaneum labial protein protein. Length = 142 Score = 21.0 bits (42), Expect = 9.8 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -1 Query: 419 IPPEASAVSLRSKIWTSPSAASI 351 IPPE + SL + SPS+ ++ Sbjct: 106 IPPEPISASLSTSNSNSPSSTNL 128 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,738 Number of Sequences: 336 Number of extensions: 2666 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18634795 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -