BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0963 (704 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC6G10.11c |ubi3||ribosomal ubiquitin fusion protein Ubi3|Schi... 28 1.5 SPAC589.10c |||ribomal-ubiquitin fusion protein Ubi5|Schizosacch... 28 1.5 SPBC29A10.04 |psm1|smc1|mitotic cohesin complex subunit Psm1 |Sc... 26 4.6 SPAC2F7.10 |||palmitoyltransferase |Schizosaccharomyces pombe|ch... 26 4.6 >SPAC6G10.11c |ubi3||ribosomal ubiquitin fusion protein Ubi3|Schizosaccharomyces pombe|chr 1|||Manual Length = 150 Score = 27.9 bits (59), Expect = 1.5 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +1 Query: 235 LRRRCQRAGFSTFELDSISYNLFTGQLHLSLSLNS 339 LRR C G STF + + L+ G+ HL+L L + Sbjct: 117 LRRECPNCGASTF-MANHKDRLYCGRCHLTLKLEN 150 >SPAC589.10c |||ribomal-ubiquitin fusion protein Ubi5|Schizosaccharomyces pombe|chr 1|||Manual Length = 150 Score = 27.9 bits (59), Expect = 1.5 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +1 Query: 235 LRRRCQRAGFSTFELDSISYNLFTGQLHLSLSLNS 339 LRR C G STF + + L+ G+ HL+L L + Sbjct: 117 LRRECPNCGASTF-MANHKDRLYCGRCHLTLKLEA 150 >SPBC29A10.04 |psm1|smc1|mitotic cohesin complex subunit Psm1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1233 Score = 26.2 bits (55), Expect = 4.6 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +3 Query: 564 GRISDFLNKLPYNLEKYQSQVSRVLEYVSEY 656 G + ++ P L K Q+S LEY SEY Sbjct: 148 GDVETIASQSPLELSKLVEQISGSLEYKSEY 178 >SPAC2F7.10 |||palmitoyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 642 Score = 26.2 bits (55), Expect = 4.6 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -3 Query: 483 GVSVNTDSDNSTSANAHVGHGDSSRSVCG 397 G V NS+ N H HG R+VCG Sbjct: 539 GTLVPPTKQNSSPKNGHGIHGSFLRTVCG 567 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,554,989 Number of Sequences: 5004 Number of extensions: 47300 Number of successful extensions: 162 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 157 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 162 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 327172622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -