BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0963 (704 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_31266| Best HMM Match : PKI (HMM E-Value=1) 29 4.9 SB_55306| Best HMM Match : DUF361 (HMM E-Value=3) 28 8.5 >SB_31266| Best HMM Match : PKI (HMM E-Value=1) Length = 1507 Score = 28.7 bits (61), Expect = 4.9 Identities = 20/50 (40%), Positives = 26/50 (52%), Gaps = 2/50 (4%) Frame = +1 Query: 262 FSTFELDSISYNLFTGQ--LHLSLSLNSVAASIDAAEGEVQIFDRKLTAD 405 FS +L SY+L TG+ LHLS + V S + G +QI KL D Sbjct: 304 FSKHDLLETSYHLRTGRIDLHLSDDSSEVTPSDPLSGGAMQIRINKLATD 353 >SB_55306| Best HMM Match : DUF361 (HMM E-Value=3) Length = 151 Score = 27.9 bits (59), Expect = 8.5 Identities = 11/40 (27%), Positives = 26/40 (65%) Frame = +3 Query: 528 EIQLNLFGREVGGRISDFLNKLPYNLEKYQSQVSRVLEYV 647 ++++NL + +GGRI+ +++L + + S+ RVL+ + Sbjct: 85 KLEINLSKKLIGGRINKKIDELNWKISNASSKTLRVLKKI 124 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,208,298 Number of Sequences: 59808 Number of extensions: 367616 Number of successful extensions: 1058 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 979 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1054 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1853669818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -