BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0962 (720 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBPB2B2.02 |mug180||esterase/lipase |Schizosaccharomyces pombe|... 29 0.88 SPAC6C3.02c |||CHCH domain protein|Schizosaccharomyces pombe|chr... 25 8.2 >SPBPB2B2.02 |mug180||esterase/lipase |Schizosaccharomyces pombe|chr 2|||Manual Length = 381 Score = 28.7 bits (61), Expect = 0.88 Identities = 13/42 (30%), Positives = 24/42 (57%) Frame = -1 Query: 210 SSKMGVSTSVGGRTTHNPGTVEVSGFLGASKTLGPGDTDLDV 85 +SK+G+ + R + + + FL S ++GPG T+LD+ Sbjct: 320 TSKIGLLKAYPNRVLMDKQGIHIGLFLEESPSIGPGMTNLDI 361 >SPAC6C3.02c |||CHCH domain protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 172 Score = 25.4 bits (53), Expect = 8.2 Identities = 11/41 (26%), Positives = 15/41 (36%) Frame = -1 Query: 213 NSSKMGVSTSVGGRTTHNPGTVEVSGFLGASKTLGPGDTDL 91 N +G H G+V GF G+ P DT + Sbjct: 60 NLVSTAAGVGIGSAIGHTVGSVITGGFSGSGSNNAPADTSV 100 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,574,873 Number of Sequences: 5004 Number of extensions: 45470 Number of successful extensions: 171 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 167 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 170 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 337208592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -