BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0958 (696 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_1817| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_39465| Best HMM Match : PDH (HMM E-Value=1.5) 28 6.3 >SB_1817| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1300 Score = 29.1 bits (62), Expect = 3.6 Identities = 19/63 (30%), Positives = 29/63 (46%) Frame = +2 Query: 191 DQNPRQRFHDLEHNNWTSPQREQINEVSNWLTANQNTLGATYSTALRAIETTRSNLVWSQ 370 D N R RF+ + S Q E EVS+W+ A Q + S I T +S ++++ Sbjct: 809 DPNHRNRFNIITSQKTFSFQVENDFEVSSWIEAVQRAIQIGLSDPAILILTPQSTILFAS 868 Query: 371 QRI 379 I Sbjct: 869 VEI 871 >SB_39465| Best HMM Match : PDH (HMM E-Value=1.5) Length = 369 Score = 28.3 bits (60), Expect = 6.3 Identities = 13/48 (27%), Positives = 27/48 (56%) Frame = +2 Query: 260 INEVSNWLTANQNTLGATYSTALRAIETTRSNLVWSQQRISEFTNYFE 403 +NE+ ++ + LG+ ++ +AIET +SN+ W + E T + + Sbjct: 304 LNELKQFIKDHDEILGSLRASK-KAIETIQSNINWMKAHGKEVTKWLQ 350 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,781,158 Number of Sequences: 59808 Number of extensions: 371892 Number of successful extensions: 1000 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 911 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 998 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1817559367 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -