BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0958 (696 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB096937-1|BAE46352.1| 207|Homo sapiens keratin associated prot... 31 3.0 >AB096937-1|BAE46352.1| 207|Homo sapiens keratin associated protein protein. Length = 207 Score = 31.5 bits (68), Expect = 3.0 Identities = 25/60 (41%), Positives = 28/60 (46%), Gaps = 3/60 (5%) Frame = -2 Query: 287 PSTSSKPHLSVLVEETSNYCVQDRGNAA*GSGR-LVNVVPEP--LESSQSVYLIGCNSGG 117 P TS + L E S+ C N S R LVNV PEP LESS V C +GG Sbjct: 143 PKTSKSKNFETL-ERASSQCQCQSQNPESSSCRPLVNVAPEPQLLESSPGVEPTCCVTGG 201 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 87,577,093 Number of Sequences: 237096 Number of extensions: 1714274 Number of successful extensions: 4274 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 4124 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4274 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8007229802 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -