BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0955 (684 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 29 0.18 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 29 0.18 AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-s... 29 0.18 AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-spe... 29 0.18 AY330180-1|AAQ16286.1| 176|Anopheles gambiae odorant-binding pr... 26 0.96 AJ618924-1|CAF02003.1| 144|Anopheles gambiae odorant-binding pr... 26 0.96 AF393486-1|AAL60411.1| 162|Anopheles gambiae twelve cysteine pr... 26 1.3 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 25 2.2 CR954257-4|CAJ14155.1| 196|Anopheles gambiae predicted protein ... 25 2.9 AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein hom... 24 5.1 M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles ... 23 6.8 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 23 6.8 AF117749-1|AAD38335.1| 372|Anopheles gambiae serine protease 14... 23 6.8 AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. 23 6.8 AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcript... 23 9.0 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 28.7 bits (61), Expect = 0.18 Identities = 14/55 (25%), Positives = 29/55 (52%) Frame = -2 Query: 536 TFDSMAVHSNSIH*NLICRMAVVVFLKVNSLESEEQQERHHKTEQTHSLRQGETQ 372 T S ++NS+H + + ++ L+ ++QQ+ HH+ +Q S Q ++Q Sbjct: 214 TISSNNNNNNSLHHGPLRDKELTEHEQLERLQQQQQQQTHHQQQQHPSSHQQQSQ 268 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 28.7 bits (61), Expect = 0.18 Identities = 14/55 (25%), Positives = 29/55 (52%) Frame = -2 Query: 536 TFDSMAVHSNSIH*NLICRMAVVVFLKVNSLESEEQQERHHKTEQTHSLRQGETQ 372 T S ++NS+H + + ++ L+ ++QQ+ HH+ +Q S Q ++Q Sbjct: 214 TISSNNNNNNSLHHGPLRDKELTEHEQLERLQQQQQQQTHHQQQQHPSSHQQQSQ 268 >AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-specific zinc-fingerC isoform protein. Length = 593 Score = 28.7 bits (61), Expect = 0.18 Identities = 14/55 (25%), Positives = 29/55 (52%) Frame = -2 Query: 536 TFDSMAVHSNSIH*NLICRMAVVVFLKVNSLESEEQQERHHKTEQTHSLRQGETQ 372 T S ++NS+H + + ++ L+ ++QQ+ HH+ +Q S Q ++Q Sbjct: 166 TISSNNNNNNSLHHGPLRDKELTEHEQLERLQQQQQQQTHHQQQQHPSSHQQQSQ 220 >AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-specific zinc-fingerC isoform protein. Length = 569 Score = 28.7 bits (61), Expect = 0.18 Identities = 14/55 (25%), Positives = 29/55 (52%) Frame = -2 Query: 536 TFDSMAVHSNSIH*NLICRMAVVVFLKVNSLESEEQQERHHKTEQTHSLRQGETQ 372 T S ++NS+H + + ++ L+ ++QQ+ HH+ +Q S Q ++Q Sbjct: 214 TISSNNNNNNSLHHGPLRDKELTEHEQLERLQQQQQQQTHHQQQQHPSSHQQQSQ 268 >AY330180-1|AAQ16286.1| 176|Anopheles gambiae odorant-binding protein AgamOBP54 protein. Length = 176 Score = 26.2 bits (55), Expect = 0.96 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 8/62 (12%) Frame = -2 Query: 314 EGAEDCSNTSSGTSYSHCRCPAPMNLAAESMSLVT--DVV------WKDRTAESCVGTAG 159 +GAEDCS++ TS H + + +S+ L+ D+V + DR GTA Sbjct: 51 DGAEDCSSSVDETSEPHDKMMCTLECKLKSLGLLNGDDLVEAKVQEYIDRLEGDWKGTAK 110 Query: 158 TI 153 TI Sbjct: 111 TI 112 >AJ618924-1|CAF02003.1| 144|Anopheles gambiae odorant-binding protein OBP5470 protein. Length = 144 Score = 26.2 bits (55), Expect = 0.96 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 8/62 (12%) Frame = -2 Query: 314 EGAEDCSNTSSGTSYSHCRCPAPMNLAAESMSLVT--DVV------WKDRTAESCVGTAG 159 +GAEDCS++ TS H + + +S+ L+ D+V + DR GTA Sbjct: 14 DGAEDCSSSVDETSEPHDKMMCTLECKLKSLGLLNGDDLVEAKVQEYIDRLEGDWKGTAK 73 Query: 158 TI 153 TI Sbjct: 74 TI 75 >AF393486-1|AAL60411.1| 162|Anopheles gambiae twelve cysteine protein 1 protein. Length = 162 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -2 Query: 314 EGAEDCSNTSSGTSYSHCRCPAPMNLAAESMSLV 213 +GAEDCS++ TS H + + +S+ L+ Sbjct: 51 DGAEDCSSSVDETSEPHDKMMCTLECKLKSLGLL 84 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 25.0 bits (52), Expect = 2.2 Identities = 9/25 (36%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = -1 Query: 183 RELCRDSRYHLCMGGY-CCKWSHQC 112 ++LC +++ L MGG+ KW+ C Sbjct: 882 KQLCEETKAALAMGGFPLRKWASNC 906 >CR954257-4|CAJ14155.1| 196|Anopheles gambiae predicted protein protein. Length = 196 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +3 Query: 462 EHYYCHPTYEVSVYTIGVDSHGIECLETS 548 EH CH V I D+H +EC+ S Sbjct: 150 EHQLCHLANIKLVVGIDEDTHELECVNIS 178 >AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein homolog protein. Length = 394 Score = 23.8 bits (49), Expect = 5.1 Identities = 14/39 (35%), Positives = 17/39 (43%) Frame = +2 Query: 92 LPSSATLHWCDHLQQYPPIHRWYLLSLHSSLQCGPSRPH 208 LP SAT W Q+ P H ++ SS Q PH Sbjct: 19 LPYSATTGWYPSNYQHQPPHPQFIGDGESSPQPAMYYPH 57 >M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 574 Score = 23.4 bits (48), Expect = 6.8 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = -1 Query: 210 RCGLEGPHCRELCRDSRYHLCMGGYCCKWSHQCRVAE 100 RCGL G R +++ LC G + S R A+ Sbjct: 533 RCGLTGHKARSCQNEAKCALCGGAHHIGHSECARSAQ 569 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 23.4 bits (48), Expect = 6.8 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = -1 Query: 261 SLPSTNEFGSRVNVLSDRCGLEGPHCRELCRDSRYHL 151 SL +T V S + +EG HCRE CR ++L Sbjct: 451 SLDNTPSCDPVTGVCSCKENVEGRHCRE-CRLGYFNL 486 >AF117749-1|AAD38335.1| 372|Anopheles gambiae serine protease 14D2 protein. Length = 372 Score = 23.4 bits (48), Expect = 6.8 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = -1 Query: 114 CRVAEDGRPGCRGDQSG 64 C E G+ CRGD G Sbjct: 304 CAGGEKGKDSCRGDSGG 320 >AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 23.4 bits (48), Expect = 6.8 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -3 Query: 679 SINIMFTYNIYCRFLFILHN 620 + N +T N+Y + +FI HN Sbjct: 664 NFNYFYTKNMYFKDVFIFHN 683 >AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 23.0 bits (47), Expect = 9.0 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -1 Query: 192 PHCRELCRDSRYH 154 P CR +C D+R H Sbjct: 858 PICRAICEDTRVH 870 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 777,603 Number of Sequences: 2352 Number of extensions: 17204 Number of successful extensions: 60 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 59 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 60 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68995575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -