BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0954 (730 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBPB2B2.02 |mug180||esterase/lipase |Schizosaccharomyces pombe|... 28 1.2 SPAC6F6.06c |rax2||cell polarity factor Rax2|Schizosaccharomyces... 27 2.7 SPBC4.03c |||COPII-coated vesicle component Sfb3 |Schizosaccharo... 26 4.8 SPAC19A8.14 |||aminoacyl-tRNA hydrolase |Schizosaccharomyces pom... 26 6.3 SPBP23A10.10 |ppk32||serine/threonine protein kinase Ppk32 |Schi... 25 8.4 SPAC20G4.04c |hus1||checkpoint clamp complex protein Hus1|Schizo... 25 8.4 >SPBPB2B2.02 |mug180||esterase/lipase |Schizosaccharomyces pombe|chr 2|||Manual Length = 381 Score = 28.3 bits (60), Expect = 1.2 Identities = 13/42 (30%), Positives = 24/42 (57%) Frame = -1 Query: 199 SSKMGVSTSVCGRTTHNPGTVEVSGFLGASKTLGPGDTDLDV 74 +SK+G+ + R + + + FL S ++GPG T+LD+ Sbjct: 320 TSKIGLLKAYPNRVLMDKQGIHIGLFLEESPSIGPGMTNLDI 361 >SPAC6F6.06c |rax2||cell polarity factor Rax2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1155 Score = 27.1 bits (57), Expect = 2.7 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +3 Query: 363 VTTSNVQMHGSYNMDTLHNDVAIINHNHVGFTNNIQRINLASGSN 497 VT SNV + YN+ + + +N++ V + N I+ S SN Sbjct: 157 VTNSNVTIEHFYNVKGNVDSLFFLNNDSVAISGNFTEISPFSSSN 201 >SPBC4.03c |||COPII-coated vesicle component Sfb3 |Schizosaccharomyces pombe|chr 2|||Manual Length = 891 Score = 26.2 bits (55), Expect = 4.8 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = +3 Query: 72 TTSRSVSPGPRVLDAPRKPLTSTVPGLWVVLPQTLVLTPILL 197 T+ R V ++L + RK + + +VLP+ LVL PIL+ Sbjct: 650 TSVRLVEGVVKILSSYRKVAANRLTPGQLVLPKNLVLLPILI 691 >SPAC19A8.14 |||aminoacyl-tRNA hydrolase |Schizosaccharomyces pombe|chr 1|||Manual Length = 205 Score = 25.8 bits (54), Expect = 6.3 Identities = 12/43 (27%), Positives = 22/43 (51%) Frame = -1 Query: 184 VSTSVCGRTTHNPGTVEVSGFLGASKTLGPGDTDLDVVVEFDG 56 +S +C R H+ G +++ G++ LG G + V+ E G Sbjct: 160 MSLGLCARVIHDAGRTQIAS--GSATVLGIGPGPVSVINEVTG 200 >SPBP23A10.10 |ppk32||serine/threonine protein kinase Ppk32 |Schizosaccharomyces pombe|chr 2|||Manual Length = 749 Score = 25.4 bits (53), Expect = 8.4 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +3 Query: 486 SGSNNFAGLGPGLPASEGPPMLLREPTTNKNAK*ASRSLPTP 611 SG +NF + P AS PP++ E T + + A+R + TP Sbjct: 687 SGLSNFNSVTPSSSASLYPPLIPSEART-PSVQPANRRVTTP 727 >SPAC20G4.04c |hus1||checkpoint clamp complex protein Hus1|Schizosaccharomyces pombe|chr 1|||Manual Length = 287 Score = 25.4 bits (53), Expect = 8.4 Identities = 16/45 (35%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = -2 Query: 639 TLFPNVRAQTALVMTWRLTWRFCWL-LAPEAASEVLPKPAAQAQV 508 T N+ T LV RFCWL L PE + V+ QV Sbjct: 5 TRISNLYTLTRLVQALDKIGRFCWLRLMPETVNFVIVPDFRMTQV 49 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,739,923 Number of Sequences: 5004 Number of extensions: 52483 Number of successful extensions: 201 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 193 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 201 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 343230174 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -