BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0953 (686 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC17A2.10c |||sequence orphan|Schizosaccharomyces pombe|chr 1|... 27 3.4 SPBP8B7.26 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||... 25 7.8 >SPAC17A2.10c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 230 Score = 26.6 bits (56), Expect = 3.4 Identities = 27/88 (30%), Positives = 40/88 (45%) Frame = +3 Query: 267 IMTTKPRSLPPDCQRWPSYCKKHTLASSWFGINTTRS*KKSVQNGTFQNVQEFMGLLLSC 446 + T P +LP P KK +L+ S F ++ R + T + F LLL Sbjct: 65 LFCTHPDTLPTSLSINP---KKLSLSFS-FPLSQKRPFPNFLHPFTGSELSLFRCLLLFF 120 Query: 447 NYLLFFFKNIFKRAFMSIMSVMSIFIVF 530 +LLFF F +F+ +S IFIV+ Sbjct: 121 FFLLFFLSFSFSFSFLFFLS--QIFIVY 146 >SPBP8B7.26 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 262 Score = 25.4 bits (53), Expect = 7.8 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -3 Query: 159 PPAPPCPRHYRHRTPRTSAACS 94 PPAPP PR RT S+ S Sbjct: 224 PPAPPKPRRLAARTSSNSSGVS 245 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,499,693 Number of Sequences: 5004 Number of extensions: 45575 Number of successful extensions: 120 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 117 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 120 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 317927284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -