BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0953 (686 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43607| Best HMM Match : INSIG (HMM E-Value=9.3e-09) 29 2.7 >SB_43607| Best HMM Match : INSIG (HMM E-Value=9.3e-09) Length = 544 Score = 29.5 bits (63), Expect = 2.7 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = -2 Query: 673 PYYITNFKYLTHFLLIS*TKIKYCLNYITRISSACKK 563 PYY +F + H++ S +K+K L YI ++S +K Sbjct: 497 PYYFISFNIVRHYVEKSSSKLKKALYYIYQMSPPSEK 533 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,066,124 Number of Sequences: 59808 Number of extensions: 323234 Number of successful extensions: 752 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 691 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 750 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1781448916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -