BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0952 (767 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z99281-28|CAB16503.1| 633|Caenorhabditis elegans Hypothetical p... 29 4.8 AL021503-1|CAA16420.2| 309|Caenorhabditis elegans Hypothetical ... 29 4.8 >Z99281-28|CAB16503.1| 633|Caenorhabditis elegans Hypothetical protein Y57G11C.1 protein. Length = 633 Score = 28.7 bits (61), Expect = 4.8 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Frame = -2 Query: 406 VTLIFTLYHNISVSLTNTNE*YKNTASNNKVRNQLS--RCVRTFA 278 +TL+ T Y+ ++V + E ASN V LS R VR+FA Sbjct: 207 ITLLMTRYYGLAVEKLSEKENDATAASNETVEEVLSAIRTVRSFA 251 >AL021503-1|CAA16420.2| 309|Caenorhabditis elegans Hypothetical protein Y68A4A.2 protein. Length = 309 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 2/34 (5%) Frame = -3 Query: 669 LPFNINGQGFNI--IQTTFFCMFNILYSINFYYH 574 L NIN NI I FF +FN+LY I +H Sbjct: 88 LVVNINSSQINIVLIALLFFALFNVLYIITQAFH 121 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,368,786 Number of Sequences: 27780 Number of extensions: 299105 Number of successful extensions: 638 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 627 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 638 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1840614650 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -