BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0950 (641 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4F10.16c |||P-type ATPase |Schizosaccharomyces pombe|chr 1||... 26 4.0 SPAC6F6.17 |rif1|tap1, tap11, SPAPJ736.01|telomere length regula... 26 4.0 >SPAC4F10.16c |||P-type ATPase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1367 Score = 26.2 bits (55), Expect = 4.0 Identities = 11/42 (26%), Positives = 21/42 (50%) Frame = -3 Query: 573 TCKREIVATLTLQTFKTRGLPHPVTIQYVNRTKTCHLNNNNN 448 +CK ++ L+T P+P +I +++ HL +N N Sbjct: 645 SCKVDLDKKKMLETLSLSDSPNPESITFISSKFVDHLQSNEN 686 >SPAC6F6.17 |rif1|tap1, tap11, SPAPJ736.01|telomere length regulator protein Rif1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1400 Score = 26.2 bits (55), Expect = 4.0 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -1 Query: 272 LVAARRAPLHLYSFHTLTNYLLDKCYNI 189 L++ ++ PL S H L N +LD C+NI Sbjct: 220 LLSCQKCPL---SIHPLCNRILDVCFNI 244 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,042,378 Number of Sequences: 5004 Number of extensions: 32382 Number of successful extensions: 53 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 53 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 53 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 287744314 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -