BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0946 (754 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value U15956-1|AAA67444.1| 129|Apis mellifera hymenoptaecin precursor... 25 0.76 AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. 25 0.76 X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alp... 21 9.4 EF013227-1|ABK54581.1| 119|Apis mellifera elongation factor 1-a... 21 9.4 AF080430-1|AAC28863.2| 208|Apis mellifera ribosomal protein S8 ... 21 9.4 >U15956-1|AAA67444.1| 129|Apis mellifera hymenoptaecin precursor protein. Length = 129 Score = 25.0 bits (52), Expect = 0.76 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +2 Query: 215 FGEEVENGPIDILKQTQQAQ*GRLSP 292 FG+E +NG I + Q+ GRLSP Sbjct: 94 FGKEYKNGFIKGQSEVQRGPGGRLSP 119 >AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. Length = 366 Score = 25.0 bits (52), Expect = 0.76 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = -2 Query: 504 SSGITPHLTLASKSHCCVSSLKKSPSVQYMA*GTPPTHR 388 SSGI PH +S S+ + SPS M +PP HR Sbjct: 28 SSGI-PHSAESSASNSPDHYERFSPSTHLMDLSSPPEHR 65 >X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alpha protein. Length = 461 Score = 21.4 bits (43), Expect = 9.4 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = +2 Query: 320 LNCHRADAAAKQVAYKGDCQR 382 L+CH A A K K C R Sbjct: 361 LDCHTAHIACKFAEIKEKCDR 381 >EF013227-1|ABK54581.1| 119|Apis mellifera elongation factor 1-alpha protein. Length = 119 Score = 21.4 bits (43), Expect = 9.4 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = +2 Query: 320 LNCHRADAAAKQVAYKGDCQR 382 L+CH A A K K C R Sbjct: 72 LDCHTAHIACKFAEIKEKCDR 92 >AF080430-1|AAC28863.2| 208|Apis mellifera ribosomal protein S8 protein. Length = 208 Score = 21.4 bits (43), Expect = 9.4 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = +2 Query: 104 LQTCNWKWATNCTLR 148 L T N+ W + CT R Sbjct: 60 LDTGNFSWGSECTTR 74 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 206,010 Number of Sequences: 438 Number of extensions: 4307 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23632110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -