BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0931 (400 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 30 0.007 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 30 0.007 AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombi... 22 2.6 EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopre... 21 4.5 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 30.3 bits (65), Expect = 0.007 Identities = 19/52 (36%), Positives = 29/52 (55%) Frame = +1 Query: 7 WWFIFLKMASVATVTRALLGKNVLNKCKVVSATSQASIKFYSTASYENIKVE 162 W FLK+ ++ TV +LG V++K + TSQ IK T +Y N K++ Sbjct: 55 WGVKFLKVVTIITVFFVVLGAAVVSKGTTLFMTSQ--IKKNVTRAYCNKKID 104 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 30.3 bits (65), Expect = 0.007 Identities = 19/52 (36%), Positives = 29/52 (55%) Frame = +1 Query: 7 WWFIFLKMASVATVTRALLGKNVLNKCKVVSATSQASIKFYSTASYENIKVE 162 W FLK+ ++ TV +LG V++K + TSQ IK T +Y N K++ Sbjct: 55 WGVKFLKVVTIITVFFVVLGAAVVSKGTTLFMTSQ--IKKNVTRAYCNKKID 104 >AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombinase protein. Length = 340 Score = 21.8 bits (44), Expect = 2.6 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 60 AGKECTEQVQSGIRNKPSIHK 122 AG T +V + NKP IHK Sbjct: 311 AGWSATSRVFATFYNKPLIHK 331 >EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopressin-like peptide protein. Length = 146 Score = 21.0 bits (42), Expect = 4.5 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = +3 Query: 27 NGFCRYCNSCFAGKECTEQVQSGI 98 +G C +SC A K C +S I Sbjct: 107 DGICCSQDSCHADKSCASDDKSPI 130 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 96,330 Number of Sequences: 336 Number of extensions: 1839 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 8541369 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -