Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= mg--0930
         (657 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC074721-1|AAH74721.1|  345|Homo sapiens HFE protein protein.          30   6.3  

>BC074721-1|AAH74721.1|  345|Homo sapiens HFE protein protein.
          Length = 345

 Score = 30.3 bits (65), Expect = 6.3
 Identities = 15/58 (25%), Positives = 24/58 (41%)
 Frame = -3

Query: 424 IDWATPTECLWPTSLRG*RHAVSDVTNKYLSKQQATANYLQAFNEHRNIMRQRERPKS 251
           +DW       WPT L   RH +    N+   ++   A   Q     R ++ Q+E  +S
Sbjct: 153 LDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQEGSES 210


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 76,583,810
Number of Sequences: 237096
Number of extensions: 1309473
Number of successful extensions: 2054
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2016
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2054
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 7366354010
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)