BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0919 (532 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 22 3.4 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 22 3.4 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 4.5 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 7.9 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 22.2 bits (45), Expect = 3.4 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = +3 Query: 390 IPEPCKCAIRLV 425 +PEPC+C R + Sbjct: 475 LPEPCRCHARCI 486 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 22.2 bits (45), Expect = 3.4 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = +3 Query: 390 IPEPCKCAIRLV 425 +PEPC+C R + Sbjct: 475 LPEPCRCHARCI 486 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.8 bits (44), Expect = 4.5 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = -2 Query: 228 SFAGVFTLTVLNDGVNYLNRA*VFWFSDIF 139 +F G+ L VLN N L F D+F Sbjct: 330 TFLGLIRLIVLNLSYNMLTHIDARMFKDLF 359 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.0 bits (42), Expect = 7.9 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -3 Query: 92 ASIGRSTITSPFPSSSNSA 36 A+ ST TSP P+SS +A Sbjct: 832 AAATSSTSTSPRPASSTAA 850 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 132,982 Number of Sequences: 438 Number of extensions: 2380 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14968302 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -