BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0909 (710 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 22 4.3 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 21 7.5 DQ855502-1|ABH88189.1| 126|Tribolium castaneum chemosensory pro... 21 9.9 DQ855495-1|ABH88182.1| 126|Tribolium castaneum chemosensory pro... 21 9.9 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 21 9.9 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 22.2 bits (45), Expect = 4.3 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = -1 Query: 425 SRASPPEAKDLRTRLKMRISPSAEPTD 345 S S E KD+ T L SP+ +P D Sbjct: 116 SPKSEKEEKDMETTLTPCASPNRKPDD 142 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 21.4 bits (43), Expect = 7.5 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = -2 Query: 652 TSWATYSRTRLTSAA*SVR*TGIFSRKLLTAGPTSRP 542 TS TYS + ++ SV T + L G TS+P Sbjct: 91 TSNPTYSSRSVMTSCSSVPTTASYGSDLYFPGATSQP 127 >DQ855502-1|ABH88189.1| 126|Tribolium castaneum chemosensory protein 16 protein. Length = 126 Score = 21.0 bits (42), Expect = 9.9 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +2 Query: 17 MKAFIFALALACV 55 M A +F LALAC+ Sbjct: 1 MTAIVFLLALACL 13 >DQ855495-1|ABH88182.1| 126|Tribolium castaneum chemosensory protein 9 protein. Length = 126 Score = 21.0 bits (42), Expect = 9.9 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +2 Query: 17 MKAFIFALALACV 55 M A +F LALAC+ Sbjct: 1 MTAIVFLLALACL 13 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 21.0 bits (42), Expect = 9.9 Identities = 8/19 (42%), Positives = 9/19 (47%) Frame = +2 Query: 275 CICVVSATSAPDST*SWLF 331 C C S + P ST W F Sbjct: 554 CYCYYSISIRPISTLGWFF 572 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,804 Number of Sequences: 336 Number of extensions: 2519 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18843005 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -