BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0909 (710 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1110 + 30973202-30973870 31 0.68 05_03_0478 - 14526180-14526578 31 0.90 12_01_0204 + 1539859-1540158 30 2.1 01_06_1057 - 34142979-34143114,34143212-34143390,34143496-341436... 29 3.6 05_04_0307 + 20066169-20066410,20066803-20066858,20067490-200675... 28 6.4 01_06_0034 + 25769436-25769701,25769749-25769887 28 8.4 >04_04_1110 + 30973202-30973870 Length = 222 Score = 31.5 bits (68), Expect = 0.68 Identities = 16/53 (30%), Positives = 27/53 (50%) Frame = -1 Query: 509 AIVIAAPMSLTMMLSARETEAVASATTFSRASPPEAKDLRTRLKMRISPSAEP 351 A+ + +P S T+ S+R+T A A ++A P + L L M +A+P Sbjct: 102 ALAVVSPTSSTVESSSRDTPAAAPVAAAAKAQVPASPSLDLSLGMSAMVAAQP 154 >05_03_0478 - 14526180-14526578 Length = 132 Score = 31.1 bits (67), Expect = 0.90 Identities = 18/38 (47%), Positives = 19/38 (50%), Gaps = 3/38 (7%) Frame = +2 Query: 551 SWTSRQQLPREDPCLPDGLRS---RGQPCSRVRRPTRH 655 SW RQ+ ED DG R RGQ R RRP RH Sbjct: 54 SWARRQRRDEEDHRQHDGYRGARRRGQEDHRRRRPRRH 91 >12_01_0204 + 1539859-1540158 Length = 99 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +2 Query: 185 YAGSWSPPGASDIINFSGRVTDVR 256 +AGSW+ G + +F GRVT VR Sbjct: 38 HAGSWNGEGQGGLAHFGGRVTRVR 61 >01_06_1057 - 34142979-34143114,34143212-34143390,34143496-34143669, 34143757-34144005,34144108-34144233,34144341-34144565, 34144657-34144747,34144837-34144951,34145312-34145366 Length = 449 Score = 29.1 bits (62), Expect = 3.6 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -3 Query: 69 CGTADTQARARAKMKAFIVDWIL 1 C DTQ +KM+A + DWI+ Sbjct: 210 CDYIDTQVEINSKMRAILADWII 232 >05_04_0307 + 20066169-20066410,20066803-20066858,20067490-20067581, 20068400-20068502,20068623-20068760,20068898-20069148 Length = 293 Score = 28.3 bits (60), Expect = 6.4 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +2 Query: 71 RDVDFEPNSQRILDIVISNLFNEIGELLRAAD 166 RDV+ PN + + D+ N +E+ ELL+ AD Sbjct: 219 RDVELSPNPEEVADVKYVNR-DELKELLKKAD 249 >01_06_0034 + 25769436-25769701,25769749-25769887 Length = 134 Score = 27.9 bits (59), Expect = 8.4 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = -3 Query: 489 DVTDNDVVCEGDGSGSLSNDVLKGKSSGSERPQDAAE 379 +V +D +C+G+G G + G ++ RPQ A E Sbjct: 16 EVESSDTICQGEGPGEGGHPDPAGPAAALLRPQVAGE 52 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,731,021 Number of Sequences: 37544 Number of extensions: 350938 Number of successful extensions: 1124 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1090 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1122 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1839213168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -