BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0909 (710 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 26 1.0 Y17700-1|CAA76820.1| 122|Anopheles gambiae hypothetical protein... 24 5.4 AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 23 9.5 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 26.2 bits (55), Expect = 1.0 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = -3 Query: 408 GSERPQDAAENADFSFSGTD*C*NSGN 328 GSE+P++A E + + SGTD +SG+ Sbjct: 1348 GSEKPKNAIEPSQEAVSGTDNANDSGD 1374 >Y17700-1|CAA76820.1| 122|Anopheles gambiae hypothetical protein protein. Length = 122 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 564 VNNFLEKIPVYLTDYAAEVS 623 VN EK+P YL++ +A V+ Sbjct: 88 VNAIYEKLPAYLSEVSARVN 107 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 23.0 bits (47), Expect = 9.5 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -3 Query: 450 SGSLSNDVLKGKSSGSERPQDAAENADFSFSGTD 349 S ++ ND +K +SGS + Q E F F D Sbjct: 1270 SVTIKNDPMK--TSGSTQQQQQMERQQFGFGNND 1301 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 651,073 Number of Sequences: 2352 Number of extensions: 12969 Number of successful extensions: 66 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 64 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 66 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 72758970 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -