BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0907 (664 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X06905-1|CAA30009.1| 489|Tribolium castaneum protein ( Triboliu... 22 3.9 U04271-2|AAA03709.1| 490|Tribolium castaneum alpha-amylase II p... 22 3.9 U04271-1|AAA03708.1| 490|Tribolium castaneum alpha-amylase I pr... 22 3.9 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 9.0 >X06905-1|CAA30009.1| 489|Tribolium castaneum protein ( Tribolium castaneum mRNAfor alhpa amylase 3'region. ). Length = 489 Score = 22.2 bits (45), Expect = 3.9 Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = +1 Query: 496 NESLSVASRRRPADPRYNPP--VLGAAGPPVSSIADV 600 NE+L V S RP RY P +L +++AD+ Sbjct: 62 NENLVVTSSNRPWWERYQPVSYILNTRSGDEAALADM 98 >U04271-2|AAA03709.1| 490|Tribolium castaneum alpha-amylase II protein. Length = 490 Score = 22.2 bits (45), Expect = 3.9 Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = +1 Query: 496 NESLSVASRRRPADPRYNPP--VLGAAGPPVSSIADV 600 NE+L V S RP RY P +L +++AD+ Sbjct: 63 NENLVVTSSNRPWWERYQPVSYILNTRSGDETALADM 99 >U04271-1|AAA03708.1| 490|Tribolium castaneum alpha-amylase I protein. Length = 490 Score = 22.2 bits (45), Expect = 3.9 Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = +1 Query: 496 NESLSVASRRRPADPRYNPP--VLGAAGPPVSSIADV 600 NE+L V S RP RY P +L +++AD+ Sbjct: 63 NENLVVTSSNRPWWERYQPVSYILNTRSGDEAALADM 99 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 9.0 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = +1 Query: 508 SVASRRRPADPRYNPP 555 S +S ++P P Y PP Sbjct: 1162 STSSWQKPTKPSYRPP 1177 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 127,397 Number of Sequences: 336 Number of extensions: 2326 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17177325 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -