BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0907 (664 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0091 + 5574528-5577254 30 1.4 06_01_0581 - 4153668-4153883,4154070-4155104,4155718-4156292,415... 28 7.6 >03_02_0091 + 5574528-5577254 Length = 908 Score = 30.3 bits (65), Expect = 1.4 Identities = 19/54 (35%), Positives = 27/54 (50%) Frame = +3 Query: 402 QSSVIMKRGARNLISIALDLKLVLNYDCVLTKRILVRRVAAEAGGPALQPSSAG 563 +SS R ++ L+ + D V T+R+ V RVAA A AL+PS G Sbjct: 681 RSSSAFVRSLGISVATLAGLRALRGLDNVRTRRLTVTRVAATAPSVALRPSMLG 734 >06_01_0581 - 4153668-4153883,4154070-4155104,4155718-4156292, 4158457-4158826,4159925-4160590,4161008-4161223, 4161725-4161793 Length = 1048 Score = 27.9 bits (59), Expect = 7.6 Identities = 16/55 (29%), Positives = 27/55 (49%), Gaps = 2/55 (3%) Frame = +3 Query: 372 IEFSFRSNAAQSSVI--MKRGARNLISIALDLKLVLNYDCVLTKRILVRRVAAEA 530 ++ FR +S+++ +RG ++++A CVL R L R VA EA Sbjct: 315 VQMGFRVVLRKSAMVGVFRRGGVTMVAVACAAAAAATVACVLMARALRRAVAREA 369 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,336,703 Number of Sequences: 37544 Number of extensions: 250480 Number of successful extensions: 689 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 678 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 689 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1667659452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -