BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0907 (664 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57703| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_42200| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_11852| Best HMM Match : fn3 (HMM E-Value=1.2e-24) 29 4.5 SB_33020| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 >SB_57703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 30.7 bits (66), Expect = 1.1 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = -3 Query: 182 AAYCDLQLPRDSPARADVTGYPSIFVYRTSITHIDM 75 + YCD+ + RD D++ Y + VYR H DM Sbjct: 2 SGYCDMSVYRDMSVYRDMSDYRDMSVYRDMSGHRDM 37 >SB_42200| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 450 Score = 29.5 bits (63), Expect = 2.6 Identities = 22/64 (34%), Positives = 30/64 (46%), Gaps = 2/64 (3%) Frame = +3 Query: 327 LIIFP*NKYIYYNERIEFSFRSNAAQSSVIMKRGARNLI--SIALDLKLVLNYDCVLTKR 500 L+ FP K Y + F RS + SVI + S+ DL + YDCVLT++ Sbjct: 349 LVPFPVTKQTYLAYHV-FLSRSLSCYRSVINYVNILKHVNNSLGADLSFMQGYDCVLTQK 407 Query: 501 ILVR 512 L R Sbjct: 408 ALRR 411 >SB_11852| Best HMM Match : fn3 (HMM E-Value=1.2e-24) Length = 691 Score = 28.7 bits (61), Expect = 4.5 Identities = 18/52 (34%), Positives = 25/52 (48%) Frame = -1 Query: 172 ATFNYHATALRALTSPDILQYSFTGLPLRTLTWVNVKRMLNTRTTINFGITY 17 A F+ + A+T P L+ FTG T+TW KR +TR F T+ Sbjct: 67 AMFSPECKVVLAITEPQDLRVFFTGPRNATITW---KRKKDTRPPDGFLFTF 115 >SB_33020| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 696 Score = 27.9 bits (59), Expect = 7.8 Identities = 15/27 (55%), Positives = 16/27 (59%) Frame = -2 Query: 162 TTTRQPCAR*RHRISFNIRLQDFHYAH 82 TTT QP A HR NIRLQD Y + Sbjct: 161 TTTSQPPA---HRFCHNIRLQDTDYCY 184 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,819,746 Number of Sequences: 59808 Number of extensions: 302255 Number of successful extensions: 735 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 700 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 735 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1705624125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -