BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0903 (428 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27773| Best HMM Match : Mito_carr (HMM E-Value=0) 28 2.9 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 28 3.8 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 28 3.8 SB_15233| Best HMM Match : fn3 (HMM E-Value=1.1e-15) 28 3.8 SB_43934| Best HMM Match : Band_41 (HMM E-Value=1.2e-15) 27 5.0 SB_19263| Best HMM Match : TAP42 (HMM E-Value=0.25) 27 5.0 SB_50387| Best HMM Match : HLH (HMM E-Value=8.2e-05) 27 6.6 SB_28905| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 >SB_27773| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 203 Score = 28.3 bits (60), Expect = 2.9 Identities = 11/40 (27%), Positives = 22/40 (55%) Frame = +2 Query: 131 CCNIWHWGSVDSISGSRARFQLSGNSGRKHSRCCTSILRK 250 C ++H G+++ I + R Q+ G+ R C TS+ ++ Sbjct: 6 CATVFHDGAMNPIEVIKQRLQMYGSPYRGVIHCATSVFKE 45 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 27.9 bits (59), Expect = 3.8 Identities = 12/25 (48%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = -2 Query: 154 PPVPYIT-APPTAFTTNGS*KPHVP 83 PP PYI APP F + PH+P Sbjct: 291 PPNPYIPPAPPNLFIPSAPPNPHIP 315 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 27.9 bits (59), Expect = 3.8 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 187 PSTGATNGVNRPPVPYITAPPTAFTTNGS 101 P T PPVP APPTA T GS Sbjct: 141 PETPPPPDTPAPPVPPTEAPPTAPPTGGS 169 >SB_15233| Best HMM Match : fn3 (HMM E-Value=1.1e-15) Length = 594 Score = 27.9 bits (59), Expect = 3.8 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +2 Query: 143 WHWGSVDSISGSRARFQLSGNSGRKHSR 226 WH S +S++G R R+ +S S H+R Sbjct: 20 WHCYSEESLTGDRRRYNISKQSTLYHTR 47 >SB_43934| Best HMM Match : Band_41 (HMM E-Value=1.2e-15) Length = 378 Score = 27.5 bits (58), Expect = 5.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 143 WHWGSVDSISGSRARFQLSGNSGRKHSRCCTSILR 247 + W VDSI+ S+A+F S + H T LR Sbjct: 265 YEWPLVDSITASKAKFYFSCATNENHKEQGTVCLR 299 >SB_19263| Best HMM Match : TAP42 (HMM E-Value=0.25) Length = 303 Score = 27.5 bits (58), Expect = 5.0 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -3 Query: 378 PNKTEKVRSWSDGENG*CLASPHGVGATMAAA 283 P K +K R W D ++G C + +G T+AAA Sbjct: 167 PEKLQKARDWDDWKDGLCGVA---IGYTVAAA 195 >SB_50387| Best HMM Match : HLH (HMM E-Value=8.2e-05) Length = 791 Score = 27.1 bits (57), Expect = 6.6 Identities = 11/40 (27%), Positives = 26/40 (65%) Frame = +2 Query: 176 SRARFQLSGNSGRKHSRCCTSILRKFMAGSIVSQLTAAAM 295 +++ FQ++G +G++ + C ++R+F + SQL+ A+ Sbjct: 129 AKSFFQVNGKNGQEET--CEDLVREFEGNGLFSQLSLEAL 166 >SB_28905| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 322 Score = 26.6 bits (56), Expect = 8.7 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 291 AAAVNCDTMLPAINFRSMLVQQRLC 217 AA +NC TM PAI +L++ C Sbjct: 38 AAVINCITMFPAIILNVLLMRAMSC 62 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,385,793 Number of Sequences: 59808 Number of extensions: 262994 Number of successful extensions: 579 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 538 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 578 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 826502419 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -