BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0900 (732 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 23 3.0 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 22 5.2 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 22 5.2 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 22 5.2 AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-act... 22 5.2 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 22 5.2 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 22 5.2 DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase doma... 22 6.8 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 22 6.8 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 6.8 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 21 9.0 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 23.0 bits (47), Expect = 3.0 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +2 Query: 161 FDSWQHNIIVRYLY 202 F+SW HN++ LY Sbjct: 160 FESWTHNVLDMVLY 173 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 22.2 bits (45), Expect = 5.2 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = -3 Query: 97 KLYYCCSN*YMRESYDLTFR 38 K Y CC Y+ ++++T R Sbjct: 222 KFYTCCDEPYLDITFNITMR 241 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 22.2 bits (45), Expect = 5.2 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = -3 Query: 97 KLYYCCSN*YMRESYDLTFR 38 K Y CC Y+ ++++T R Sbjct: 222 KFYTCCDEPYLDITFNITMR 241 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 22.2 bits (45), Expect = 5.2 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = -3 Query: 97 KLYYCCSN*YMRESYDLTFR 38 K Y CC Y+ ++++T R Sbjct: 218 KFYTCCDEPYLDITFNITMR 237 >AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-activated ion channelvariant T protein. Length = 288 Score = 22.2 bits (45), Expect = 5.2 Identities = 10/35 (28%), Positives = 16/35 (45%) Frame = -2 Query: 563 YVLKICFFFNFALDHCEIELFCINVANAPVTFYYY 459 +V+ C F F D C + L N+ PV ++ Sbjct: 79 WVIHPCSSFRFYWDLCMLLLLVANLIILPVAISFF 113 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 22.2 bits (45), Expect = 5.2 Identities = 10/35 (28%), Positives = 16/35 (45%) Frame = -2 Query: 563 YVLKICFFFNFALDHCEIELFCINVANAPVTFYYY 459 +V+ C F F D C + L N+ PV ++ Sbjct: 79 WVIHPCSSFRFYWDLCMLLLLVANLIILPVAISFF 113 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 22.2 bits (45), Expect = 5.2 Identities = 10/35 (28%), Positives = 16/35 (45%) Frame = -2 Query: 563 YVLKICFFFNFALDHCEIELFCINVANAPVTFYYY 459 +V+ C F F D C + L N+ PV ++ Sbjct: 79 WVIHPCSSFRFYWDLCMLLLLVANLIILPVAISFF 113 >DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase domain protein protein. Length = 448 Score = 21.8 bits (44), Expect = 6.8 Identities = 8/28 (28%), Positives = 16/28 (57%) Frame = -1 Query: 183 ILCCQESKLISVKTISQQYHPVDISIEH 100 + C +E + + KTI Y+P +S ++ Sbjct: 401 VSCLRELRNLGRKTIMVNYNPETVSTDY 428 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.8 bits (44), Expect = 6.8 Identities = 7/25 (28%), Positives = 15/25 (60%) Frame = +1 Query: 505 SSISQWSRAKLKKKQIFNTYTYFVT 579 +++ +W R K+K++F FV+ Sbjct: 402 AAVDEWPRLLRKRKELFIAIVCFVS 426 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.8 bits (44), Expect = 6.8 Identities = 7/25 (28%), Positives = 15/25 (60%) Frame = +1 Query: 505 SSISQWSRAKLKKKQIFNTYTYFVT 579 +++ +W R K+K++F FV+ Sbjct: 455 AAVDEWPRLLRKRKELFIAIVCFVS 479 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 21.4 bits (43), Expect = 9.0 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = -2 Query: 227 KTLKKTIENTDNVQLYCVARNQNLFLSKQSVNNITQWT 114 K L KTI T ++ L + N + SV +WT Sbjct: 468 KELSKTINFTYSLALSPDGQFGNYIIKNNSVGGKKEWT 505 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 193,310 Number of Sequences: 438 Number of extensions: 4036 Number of successful extensions: 18 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22779405 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -