BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0896 (503 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY752905-1|AAV30079.1| 100|Anopheles gambiae peroxidase 11 prot... 27 0.48 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 27 0.48 AY334004-1|AAR01129.1| 194|Anopheles gambiae integrin protein. 25 1.1 AY334003-1|AAR01128.1| 194|Anopheles gambiae integrin protein. 25 1.1 AY334002-1|AAR01127.1| 194|Anopheles gambiae integrin protein. 25 1.1 AY334001-1|AAR01126.1| 194|Anopheles gambiae integrin protein. 25 1.1 AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin s... 25 1.1 AJ439060-16|CAD27767.1| 278|Anopheles gambiae hypothetical prot... 25 1.5 AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 pr... 24 2.5 AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CY... 24 3.4 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 23 5.9 >AY752905-1|AAV30079.1| 100|Anopheles gambiae peroxidase 11 protein. Length = 100 Score = 26.6 bits (56), Expect = 0.48 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -2 Query: 196 TYNLNFIVFANRHGFYIEFLS*FLRQGRGHQHSPY 92 T+ L ++FA R+ F + S +++GR H PY Sbjct: 27 TFGLTRLLFAGRNPFGSDLASLNIQRGRDHALRPY 61 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 26.6 bits (56), Expect = 0.48 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 3/39 (7%) Frame = -2 Query: 271 SSQCIHKLFTIHLHHFA---NLLAFVVSTYNLNFIVFAN 164 SS+C+ K+F + H+F NL FVV ++ +V ++ Sbjct: 1667 SSECLMKIFALRYHYFIEPWNLFDFVVVILSILGLVLSD 1705 >AY334004-1|AAR01129.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 25.4 bits (53), Expect = 1.1 Identities = 16/41 (39%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -3 Query: 468 CLRGLHGCG-SFLGVFTLVFAKCSQSALCSAIEDCFAVFIH 349 C G C SF G F Q ALCS+ EDC +H Sbjct: 42 CNCGRCSCDESFFGPFCET-KDGEQPALCSSYEDCIRCAVH 81 >AY334003-1|AAR01128.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 25.4 bits (53), Expect = 1.1 Identities = 16/41 (39%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -3 Query: 468 CLRGLHGCG-SFLGVFTLVFAKCSQSALCSAIEDCFAVFIH 349 C G C SF G F Q ALCS+ EDC +H Sbjct: 42 CNCGRCSCDESFFGPFCET-KDGEQPALCSSYEDCIRCAVH 81 >AY334002-1|AAR01127.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 25.4 bits (53), Expect = 1.1 Identities = 16/41 (39%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -3 Query: 468 CLRGLHGCG-SFLGVFTLVFAKCSQSALCSAIEDCFAVFIH 349 C G C SF G F Q ALCS+ EDC +H Sbjct: 42 CNCGRCSCDESFFGPFCET-KDGEQPALCSSYEDCIRCAVH 81 >AY334001-1|AAR01126.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 25.4 bits (53), Expect = 1.1 Identities = 16/41 (39%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -3 Query: 468 CLRGLHGCG-SFLGVFTLVFAKCSQSALCSAIEDCFAVFIH 349 C G C SF G F Q ALCS+ EDC +H Sbjct: 42 CNCGRCSCDESFFGPFCET-KDGEQPALCSSYEDCIRCAVH 81 >AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin subunit AgBnu protein. Length = 803 Score = 25.4 bits (53), Expect = 1.1 Identities = 16/41 (39%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -3 Query: 468 CLRGLHGCG-SFLGVFTLVFAKCSQSALCSAIEDCFAVFIH 349 C G C SF G F Q ALCS+ EDC +H Sbjct: 618 CNCGRCSCDESFFGPFCET-KDGEQPALCSSYEDCIRCAVH 657 >AJ439060-16|CAD27767.1| 278|Anopheles gambiae hypothetical protein protein. Length = 278 Score = 25.0 bits (52), Expect = 1.5 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = -2 Query: 121 QGRGHQHSPYM*RSTEMPLPVFPS*G 44 Q GH HS +S +P+PVF G Sbjct: 150 QAAGHLHSSVSEKSKTVPVPVFQKVG 175 >AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 protein. Length = 507 Score = 24.2 bits (50), Expect = 2.5 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -3 Query: 150 TLNFCLSSLDRGEDINTRL 94 T+NFCL L + DI RL Sbjct: 319 TMNFCLYELAKNPDIQGRL 337 >AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CYP6P2 protein. Length = 507 Score = 23.8 bits (49), Expect = 3.4 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -3 Query: 150 TLNFCLSSLDRGEDINTRL 94 T+NFCL L + DI RL Sbjct: 320 TMNFCLYELAKHPDIQERL 338 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 23.0 bits (47), Expect = 5.9 Identities = 18/64 (28%), Positives = 28/64 (43%), Gaps = 2/64 (3%) Frame = +3 Query: 273 SKRKGQWSNSICRHSPF-KVCDCQVEDE*RPQSN-PRSQSKGQTGCTWQRQG*IHRGNCH 446 S++ SNS+ HS + V + E E P S+S+ + +H G+ H Sbjct: 1266 SRKNSADSNSVATHSSYYSVTGVEPEKEFVVMPRLPPSRSEDTLNSSHLHHH-LHHGHHH 1324 Query: 447 SHGG 458 HGG Sbjct: 1325 HHGG 1328 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 534,749 Number of Sequences: 2352 Number of extensions: 12453 Number of successful extensions: 30 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 45245913 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -