BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0890 (714 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC26A3.15c |nsp1||nucleoporin Nsp1|Schizosaccharomyces pombe|c... 27 3.5 SPAC3A12.06c |||sodium/calcium exchanger |Schizosaccharomyces po... 26 4.7 SPAC6C3.02c |||CHCH domain protein|Schizosaccharomyces pombe|chr... 25 8.1 >SPAC26A3.15c |nsp1||nucleoporin Nsp1|Schizosaccharomyces pombe|chr 1|||Manual Length = 598 Score = 26.6 bits (56), Expect = 3.5 Identities = 22/75 (29%), Positives = 34/75 (45%), Gaps = 7/75 (9%) Frame = +1 Query: 226 SHSRMAELPSRSSLLTNTRSVTAAHC-----WRTRNAQ--ARQFTLAFGTANIFSGGTRV 384 S ++ A P+ + L NT + T++ + + NA + T +FG A T Sbjct: 23 SAAQGAATPAATGLFGNTNNNTSSTAPSGGLFGSNNASNTSAPSTFSFGKAATTGNSTNA 82 Query: 385 TTSSVHLHGSYNMNN 429 +TSS GS N NN Sbjct: 83 STSSPFSFGSTNTNN 97 >SPAC3A12.06c |||sodium/calcium exchanger |Schizosaccharomyces pombe|chr 1|||Manual Length = 743 Score = 26.2 bits (55), Expect = 4.7 Identities = 19/77 (24%), Positives = 35/77 (45%), Gaps = 1/77 (1%) Frame = +1 Query: 283 SVTAAHCWRTRNAQARQFTLAFGTANIFSGGTRVTTSSV-HLHGSYNMNNLNNDVAIINH 459 S+ AA +R+ N + + NI G + + H + + +N V+ IN+ Sbjct: 365 SLLAALDFRSSNEEQHPGLRSLDPLNIQDGDLTMHPMHIRHSQSDFYPSGINTPVSGINY 424 Query: 460 NHVGFNNNIQRINLASE 510 ++GF+ N +L SE Sbjct: 425 PNLGFSANNSVQSLVSE 441 >SPAC6C3.02c |||CHCH domain protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 172 Score = 25.4 bits (53), Expect = 8.1 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = -2 Query: 191 VGGRTTHNPGTVEVSGFLGASKTLSPGDTDL 99 +G H G+V GF G+ +P DT + Sbjct: 70 IGSAIGHTVGSVITGGFSGSGSNNAPADTSV 100 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,392,452 Number of Sequences: 5004 Number of extensions: 40150 Number of successful extensions: 135 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 131 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 134 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 333194204 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -