BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0886 (520 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g07070.1 68414.m00753 60S ribosomal protein L35a (RPL35aA) si... 82 2e-16 At1g74270.1 68414.m08601 60S ribosomal protein L35a (RPL35aC) si... 81 3e-16 At3g55750.1 68416.m06194 60S ribosomal protein L35a (RPL35aD) ri... 80 1e-15 At1g41880.1 68414.m04836 60S ribosomal protein L35a (RPL35aB) id... 80 1e-15 At3g05180.1 68416.m00565 GDSL-motif lipase/hydrolase family prot... 31 0.61 At4g21130.1 68417.m03055 transducin family protein / WD-40 repea... 27 5.7 At5g51195.1 68418.m06348 hypothetical protein 27 7.6 >At1g07070.1 68414.m00753 60S ribosomal protein L35a (RPL35aA) similar to ribosomal protein L35a GI:57118 from [Rattus norvegicus] Length = 112 Score = 82.2 bits (194), Expect = 2e-16 Identities = 40/74 (54%), Positives = 48/74 (64%) Frame = +1 Query: 250 SLYAGKHCVYVYRAKKRTPIPGGPRGKKTKLRAIWGKVTRPHGNSGSVRAKFKSNLPAQA 429 S Y GK Y+Y+AK + + R IWGKVTRPHGNSG VRAKF SNLP ++ Sbjct: 47 SWYKGKRMAYIYKAKTKK--------NGSHYRCIWGKVTRPHGNSGVVRAKFTSNLPPKS 98 Query: 430 MGHRIRVMLYPSRI 471 MG R+RV +YPS I Sbjct: 99 MGSRVRVFMYPSNI 112 Score = 37.1 bits (82), Expect = 0.007 Identities = 15/29 (51%), Positives = 20/29 (68%) Frame = +2 Query: 143 RLYAKAVFTGYKRGLRNQHENTALLKVEG 229 RLY + GYKR NQ+ NT+L++VEG Sbjct: 11 RLYVRGTILGYKRSKSNQYPNTSLVQVEG 39 >At1g74270.1 68414.m08601 60S ribosomal protein L35a (RPL35aC) similar to ribosomal protein L33B GB:NP_014877 from [Saccharomyces cerevisiae] Length = 112 Score = 81.4 bits (192), Expect = 3e-16 Identities = 39/72 (54%), Positives = 47/72 (65%) Frame = +1 Query: 256 YAGKHCVYVYRAKKRTPIPGGPRGKKTKLRAIWGKVTRPHGNSGSVRAKFKSNLPAQAMG 435 Y GK Y+Y+AK + + R IWGKVTRPHGNSG VRAKF SNLP ++MG Sbjct: 49 YKGKRMAYIYKAKTKK--------NGSHYRCIWGKVTRPHGNSGVVRAKFTSNLPPKSMG 100 Query: 436 HRIRVMLYPSRI 471 R+RV +YPS I Sbjct: 101 SRVRVFMYPSNI 112 Score = 37.5 bits (83), Expect = 0.005 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = +2 Query: 143 RLYAKAVFTGYKRGLRNQHENTALLKVEGAKDRND 247 RLY + GYKR NQ+ NT+L+++EG + + Sbjct: 11 RLYVRGTILGYKRSKSNQYPNTSLVQIEGVNTQEE 45 >At3g55750.1 68416.m06194 60S ribosomal protein L35a (RPL35aD) ribosomal protein L35a.e.c15, Saccharomyces cerevisiae, PIR:S44069 Length = 111 Score = 79.8 bits (188), Expect = 1e-15 Identities = 38/72 (52%), Positives = 47/72 (65%) Frame = +1 Query: 256 YAGKHCVYVYRAKKRTPIPGGPRGKKTKLRAIWGKVTRPHGNSGSVRAKFKSNLPAQAMG 435 Y GK Y+Y+AK + + R IWGKVTRPHGNSG VR+KF SNLP ++MG Sbjct: 48 YKGKRLAYIYKAKTKK--------NGSHYRCIWGKVTRPHGNSGVVRSKFTSNLPPKSMG 99 Query: 436 HRIRVMLYPSRI 471 R+RV +YPS I Sbjct: 100 ARVRVFMYPSNI 111 Score = 37.1 bits (82), Expect = 0.007 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = +2 Query: 143 RLYAKAVFTGYKRGLRNQHENTALLKVEGAKDRND 247 RLY + GYKR NQ+ NT+L+++EG + + Sbjct: 10 RLYVRGTVLGYKRSKSNQYPNTSLVQIEGVNTQEE 44 >At1g41880.1 68414.m04836 60S ribosomal protein L35a (RPL35aB) identical to GB:CAB81600 from [Arabidopsis thaliana] Length = 111 Score = 79.8 bits (188), Expect = 1e-15 Identities = 38/72 (52%), Positives = 47/72 (65%) Frame = +1 Query: 256 YAGKHCVYVYRAKKRTPIPGGPRGKKTKLRAIWGKVTRPHGNSGSVRAKFKSNLPAQAMG 435 Y GK Y+Y+AK + + R IWGKVTRPHGNSG VR+KF SNLP ++MG Sbjct: 48 YKGKRLAYIYKAKTKK--------NGSHYRCIWGKVTRPHGNSGVVRSKFTSNLPPKSMG 99 Query: 436 HRIRVMLYPSRI 471 R+RV +YPS I Sbjct: 100 ARVRVFMYPSNI 111 Score = 37.5 bits (83), Expect = 0.005 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = +2 Query: 143 RLYAKAVFTGYKRGLRNQHENTALLKVEGAKDRND 247 RLY + GYKR NQ+ NT+L+++EG + + Sbjct: 10 RLYVRGTVLGYKRSKSNQYPNTSLIQIEGVNTQEE 44 >At3g05180.1 68416.m00565 GDSL-motif lipase/hydrolase family protein similar to early nodulin ENOD8 [Medicago sativa] GI:304037, elicitor-induced glycoprotein iEP4 [Daucus carota] GI:1911765, lanatoside 15'-O-acetylesterase [Digitalis lanata] GI:3688284; contains InterPro Entry IPR001087 Lipolytic enzyme, G-D-S-L family Length = 379 Score = 30.7 bits (66), Expect = 0.61 Identities = 18/62 (29%), Positives = 31/62 (50%) Frame = -2 Query: 396 SDTARVAMWAGHLAPDSTQLGFFATGTSGNWCPLLSSVHIDAMLASIKTASLRSFAPSTL 217 SDT ++ G L S ++ FF + TSG +C + +D ++ +I LR + S Sbjct: 45 SDTGELSSGLGFLPQPSYEITFFRSPTSGRFCN--GRLIVDFLMEAIDRPYLRPYLDSIS 102 Query: 216 RR 211 R+ Sbjct: 103 RQ 104 >At4g21130.1 68417.m03055 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); some similarity to a group of proteins with homology to mammalian apoptosis regulators identified in zebrafish (PUBMED:10917738)Apaf-1(gi:7677507) Length = 537 Score = 27.5 bits (58), Expect = 5.7 Identities = 18/57 (31%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = -2 Query: 453 HHSYSVS-HSLGREVRLELGSDTARVAMWAGHLAPDSTQLGFFATGTSGNWCPLLSS 286 H S +S +LGRE L +G D G + P+ST+L + A+ ++ C ++S Sbjct: 304 HQSELLSIDALGRERVLSVGRDRTMQLYKVGIVVPESTRLIYRASESNFECCCFVNS 360 >At5g51195.1 68418.m06348 hypothetical protein Length = 267 Score = 27.1 bits (57), Expect = 7.6 Identities = 13/39 (33%), Positives = 18/39 (46%) Frame = -2 Query: 417 EVRLELGSDTARVAMWAGHLAPDSTQLGFFATGTSGNWC 301 E++ E+ S+ W D T FFA+ SG WC Sbjct: 209 EIQAEMESEDVAATFWID----DETHDDFFASSKSGWWC 243 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,718,924 Number of Sequences: 28952 Number of extensions: 229861 Number of successful extensions: 663 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 630 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 659 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 947539968 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -