BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0875 (711 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory recept... 23 3.2 EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 21 7.5 AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 21 7.5 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 7.5 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 7.5 >AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory receptor candidate 50 protein. Length = 350 Score = 22.6 bits (46), Expect = 3.2 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +3 Query: 240 LAYSCGSTFTNSGGVVHNVNRIIIHPN 320 LAY C G + ++VN++I N Sbjct: 284 LAYLCDKVQLKIGEIKYSVNKLIFRSN 310 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 21.4 bits (43), Expect = 7.5 Identities = 10/29 (34%), Positives = 13/29 (44%) Frame = -1 Query: 684 EQTPTRTRLWRRGPPESPWHWSRPPTSKT 598 ++T TRLW R + WS P T Sbjct: 560 DETSLDTRLWPRAAAFAERVWSDPQLDVT 588 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 21.4 bits (43), Expect = 7.5 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +2 Query: 611 GGRDQCQGDSGG 646 GGRD +GD GG Sbjct: 97 GGRDGDRGDGGG 108 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 7.5 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = -2 Query: 566 G*WVCNVGRRHSD*WSRPGLTELLRIRPSERC 471 G W+ V + W P L+E L + +E C Sbjct: 135 GTWIRAVRKCLYKLWKMPSLSEFLSLFGTETC 166 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 7.5 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = -2 Query: 566 G*WVCNVGRRHSD*WSRPGLTELLRIRPSERC 471 G W+ V + W P L+E L + +E C Sbjct: 135 GTWIRAVRKCLYKLWKMPSLSEFLSLFGTETC 166 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 185,343 Number of Sequences: 336 Number of extensions: 4740 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18843005 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -