BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0870 (582 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ370040-1|ABD18601.1| 121|Anopheles gambiae putative TIL domai... 24 4.1 AY341205-1|AAR13769.1| 285|Anopheles gambiae period protein. 24 4.1 AY341204-1|AAR13768.1| 285|Anopheles gambiae period protein. 24 4.1 AY341203-1|AAR13767.1| 285|Anopheles gambiae period protein. 24 4.1 AY341202-1|AAR13766.1| 285|Anopheles gambiae period protein. 24 4.1 AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. 23 5.5 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 23 7.2 AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 23 7.2 AJ459961-1|CAD31060.1| 700|Anopheles gambiae prophenoloxidase 8... 23 9.5 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 23 9.5 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 23 9.5 >DQ370040-1|ABD18601.1| 121|Anopheles gambiae putative TIL domain polypeptide protein. Length = 121 Score = 23.8 bits (49), Expect = 4.1 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = +3 Query: 315 CNPWTGSRS*TKPTTKGSRTMQSCNP 392 C P G R+ T S +SCNP Sbjct: 70 CGPACGDRTCTNQRKNDSACRRSCNP 95 >AY341205-1|AAR13769.1| 285|Anopheles gambiae period protein. Length = 285 Score = 23.8 bits (49), Expect = 4.1 Identities = 10/29 (34%), Positives = 19/29 (65%) Frame = +2 Query: 317 QPMDRISLLNKTDYEGIPDDAELQSDISP 403 QP +++LLN++D+ D+ + +ISP Sbjct: 119 QPELKLNLLNESDFTFSERDSVMLGEISP 147 >AY341204-1|AAR13768.1| 285|Anopheles gambiae period protein. Length = 285 Score = 23.8 bits (49), Expect = 4.1 Identities = 10/29 (34%), Positives = 19/29 (65%) Frame = +2 Query: 317 QPMDRISLLNKTDYEGIPDDAELQSDISP 403 QP +++LLN++D+ D+ + +ISP Sbjct: 119 QPELKLNLLNESDFTFSERDSVMLGEISP 147 >AY341203-1|AAR13767.1| 285|Anopheles gambiae period protein. Length = 285 Score = 23.8 bits (49), Expect = 4.1 Identities = 10/29 (34%), Positives = 19/29 (65%) Frame = +2 Query: 317 QPMDRISLLNKTDYEGIPDDAELQSDISP 403 QP +++LLN++D+ D+ + +ISP Sbjct: 119 QPELKLNLLNESDFTFSERDSVMLGEISP 147 >AY341202-1|AAR13766.1| 285|Anopheles gambiae period protein. Length = 285 Score = 23.8 bits (49), Expect = 4.1 Identities = 10/29 (34%), Positives = 19/29 (65%) Frame = +2 Query: 317 QPMDRISLLNKTDYEGIPDDAELQSDISP 403 QP +++LLN++D+ D+ + +ISP Sbjct: 119 QPELKLNLLNESDFTFSERDSVMLGEISP 147 >AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. Length = 525 Score = 23.4 bits (48), Expect = 5.5 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +2 Query: 521 IITQSWDPRWRQSAGVP 571 + T++WD RW + VP Sbjct: 322 LATEAWDLRWSEEQQVP 338 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 23.0 bits (47), Expect = 7.2 Identities = 11/38 (28%), Positives = 18/38 (47%) Frame = +2 Query: 368 PDDAELQSDISPTSVASEAAKFRRKNMTRAASESKLMP 481 PD + ++ +SPT + AA + AA+ S P Sbjct: 552 PDTRKFENMLSPTMASQAAAAAAAISAAAAAANSSFKP 589 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 23.0 bits (47), Expect = 7.2 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = -2 Query: 572 PELPLTDATGDPNSELLSMSTVSVCL 495 PE PL D PNS L T+SVCL Sbjct: 171 PEPPLAD----PNSMHLFALTLSVCL 192 >AJ459961-1|CAD31060.1| 700|Anopheles gambiae prophenoloxidase 8 protein. Length = 700 Score = 22.6 bits (46), Expect = 9.5 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +3 Query: 105 PELSVIPEAAVEESKEGSAIIDE 173 P+ + P A V +EGS ++DE Sbjct: 166 PDQFIDPAAQVRMMEEGSIVLDE 188 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 22.6 bits (46), Expect = 9.5 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -3 Query: 577 PGRNSR*LTPPGIPTLSYYQCQRYPSAYF 491 PG S LTPP +P Y R P A F Sbjct: 1361 PGARSLPLTPPSVP----YASDRPPVATF 1385 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 22.6 bits (46), Expect = 9.5 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -3 Query: 577 PGRNSR*LTPPGIPTLSYYQCQRYPSAYF 491 PG S LTPP +P Y R P A F Sbjct: 1358 PGARSLPLTPPSVP----YASDRPPVATF 1382 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 496,268 Number of Sequences: 2352 Number of extensions: 7946 Number of successful extensions: 21 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 55506924 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -