BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0869 (587 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g21080.1 68415.m02502 expressed protein 27 7.0 At5g08280.1 68418.m00975 hydroxymethylbilane synthase / porphobi... 27 9.3 >At2g21080.1 68415.m02502 expressed protein Length = 414 Score = 27.5 bits (58), Expect = 7.0 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +1 Query: 358 YRTNLGTLKCIFWTFTCKYTKFLFFCLHKKF 450 YRT + L CI + TC+ F LHK F Sbjct: 195 YRTGVFLLVCILFRLTCELQILRFRGLHKLF 225 >At5g08280.1 68418.m00975 hydroxymethylbilane synthase / porphobilinogen deaminase, chloroplast / pre-uroporphyrinogen synthase identical to SP|Q43316 Length = 382 Score = 27.1 bits (57), Expect = 9.3 Identities = 15/55 (27%), Positives = 27/55 (49%) Frame = -2 Query: 262 RSSTRTALTRLPAGAVNLTLRTRQLIVAARLTTKLRKSLSLEVILPILKALALSV 98 R + +T L++L G V TL + +T + LSL+ +LP + A+ + Sbjct: 223 RGNVQTRLSKLQGGKVQATLLALAGLKRLSMTENVASILSLDEMLPAVAQGAIGI 277 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,055,592 Number of Sequences: 28952 Number of extensions: 207823 Number of successful extensions: 408 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 404 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 407 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1161268208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -