BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0867 (612 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 25 0.66 AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless pr... 25 0.66 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 6.2 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 21 6.2 AM292342-1|CAL23154.2| 386|Tribolium castaneum gustatory recept... 21 8.2 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 24.6 bits (51), Expect = 0.66 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +1 Query: 277 QADHPRQVQRHHQVAGFQPAGRQG 348 Q HP+ Q HHQ G+QG Sbjct: 172 QEQHPQHHQPHHQQQHMMYGGQQG 195 >AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless protein. Length = 325 Score = 24.6 bits (51), Expect = 0.66 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +1 Query: 277 QADHPRQVQRHHQVAGFQPAGRQG 348 Q HP+ Q HHQ G+QG Sbjct: 174 QEQHPQHHQPHHQQQHMMYGGQQG 197 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.4 bits (43), Expect = 6.2 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = -2 Query: 428 LLRHPGTSS*LSDCKCLPILSACAHTPPCRPAGWNP 321 +L+ P T D K LP H PP P G NP Sbjct: 720 MLQSPLTPHEAFDVK-LPPPPHPHHQPPRNPVGTNP 754 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.4 bits (43), Expect = 6.2 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = -2 Query: 428 LLRHPGTSS*LSDCKCLPILSACAHTPPCRPAGWNP 321 +L+ P T D K LP H PP P G NP Sbjct: 612 MLQSPLTPHEAFDVK-LPPPPHPHHQPPRNPVGTNP 646 >AM292342-1|CAL23154.2| 386|Tribolium castaneum gustatory receptor candidate 21 protein. Length = 386 Score = 21.0 bits (42), Expect = 8.2 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +3 Query: 150 KYRNEDDKQKETIQAKNALESY 215 ++ N D Q+ + + NA ESY Sbjct: 365 QFNNSDFVQRNSTEFDNATESY 386 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 118,417 Number of Sequences: 336 Number of extensions: 2247 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15561709 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -