BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0860 (565 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 23 2.1 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 23 2.1 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 21 8.6 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 23.0 bits (47), Expect = 2.1 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 Query: 349 ILHFYTICLKLLMKKCSYRFTEVLNAILKTFVL 447 IL+F CL+ + S EV A L+ F+L Sbjct: 282 ILYFIRGCLQTYLINASTYLNEVHTASLRKFIL 314 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 23.0 bits (47), Expect = 2.1 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 Query: 349 ILHFYTICLKLLMKKCSYRFTEVLNAILKTFVL 447 IL+F CL+ + S EV A L+ F+L Sbjct: 320 ILYFIRGCLQTYLINASTYLNEVHTASLRKFIL 352 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 21.0 bits (42), Expect = 8.6 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -3 Query: 308 FCTLNNIKLK 279 FC L N+KLK Sbjct: 203 FCNLENVKLK 212 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,528 Number of Sequences: 438 Number of extensions: 3349 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16317903 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -