BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0859 (428 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC16E8.07c |vph1||V-type ATPase subunit a|Schizosaccharomyces ... 27 0.93 SPBC1861.03 |mak10||NatC N-acetyltransferase complex subunit Mak... 25 5.0 SPCC1442.05c |||conserved fungal protein|Schizosaccharomyces pom... 25 5.0 SPAC29A4.19c |||P-type ATPase |Schizosaccharomyces pombe|chr 1||... 25 5.0 SPBC25H2.13c |cdc20|pol2|DNA polymerase epsilon catalytic subuni... 24 8.7 SPCC576.05 |||nucear export factor|Schizosaccharomyces pombe|chr... 24 8.7 SPAC3F10.06c |||initiator methionine tRNA 2'-O-ribosyl phosphate... 24 8.7 >SPAC16E8.07c |vph1||V-type ATPase subunit a|Schizosaccharomyces pombe|chr 1|||Manual Length = 805 Score = 27.5 bits (58), Expect = 0.93 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -3 Query: 78 LVFLNSYFFKLGFIV*RSQNTFCWFL 1 L+F+NSY KL I+ TFC FL Sbjct: 517 LLFMNSYKMKLSIILGVIHMTFCLFL 542 >SPBC1861.03 |mak10||NatC N-acetyltransferase complex subunit Mak10 |Schizosaccharomyces pombe|chr 2|||Manual Length = 708 Score = 25.0 bits (52), Expect = 5.0 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +1 Query: 277 KTTKNPPCLISTVKSGFFEPPLFIMIIIHI*YLKNNLYSCL 399 K T LI+ +KSGF + + YLKN L C+ Sbjct: 635 KFTAAKNSLINVIKSGFEQNEFINPYFLQTNYLKNLLCCCI 675 >SPCC1442.05c |||conserved fungal protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 177 Score = 25.0 bits (52), Expect = 5.0 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = -3 Query: 66 NSYFFKLGFIV*RSQNTFCWFL 1 +S F LG++ +++N F WFL Sbjct: 32 SSIFHALGYVGLKTENAFGWFL 53 >SPAC29A4.19c |||P-type ATPase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1096 Score = 25.0 bits (52), Expect = 5.0 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = +1 Query: 280 TTKNPPCLISTVKSGF 327 +T + PCLIS V++GF Sbjct: 352 STPSTPCLISVVRTGF 367 >SPBC25H2.13c |cdc20|pol2|DNA polymerase epsilon catalytic subunit a Pol2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 2199 Score = 24.2 bits (50), Expect = 8.7 Identities = 13/44 (29%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +3 Query: 201 KNMKIIFSLWLFLRRAASMKNFNVVKNDKKSAMSDFDGKI-RVF 329 KN+K ++++ F A +K F V + + + DF +I +VF Sbjct: 948 KNLKKRYAVFNFDGSLAELKGFEVKRRGELKLIKDFQSQIFKVF 991 >SPCC576.05 |||nucear export factor|Schizosaccharomyces pombe|chr 3|||Manual Length = 1024 Score = 24.2 bits (50), Expect = 8.7 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = -3 Query: 174 NHSETISPPYLNCIIHNPSFKKQILQKP 91 N +ET PP N I N K I KP Sbjct: 552 NGTETFIPPVQNSITSNKEAVKPIKNKP 579 >SPAC3F10.06c |||initiator methionine tRNA 2'-O-ribosyl phosphate transferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 453 Score = 24.2 bits (50), Expect = 8.7 Identities = 10/36 (27%), Positives = 21/36 (58%) Frame = +1 Query: 241 DEQLV*RILMLSKTTKNPPCLISTVKSGFFEPPLFI 348 +EQL +I +L +T+N P + ++ + P+F+ Sbjct: 263 EEQLEQKISLLLSSTRNSPTMSNSSLTHLLPTPIFV 298 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,816,098 Number of Sequences: 5004 Number of extensions: 35684 Number of successful extensions: 81 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 78 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 81 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 154448264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -