BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0858 (678 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855490-1|ABH88177.1| 133|Tribolium castaneum chemosensory pro... 25 0.75 AM292343-1|CAL23155.2| 301|Tribolium castaneum gustatory recept... 21 9.3 >DQ855490-1|ABH88177.1| 133|Tribolium castaneum chemosensory protein 4 protein. Length = 133 Score = 24.6 bits (51), Expect = 0.75 Identities = 19/63 (30%), Positives = 29/63 (46%) Frame = +2 Query: 224 SHPQADKHRNQQLNARVVEAETKLKSEVTRIKKKLQIQITELELSLDVANKTNIDLQKTI 403 +H K+ N L VV+ E LKS V + +K + LEL ++ + D K Sbjct: 23 THKYTTKYDNIDLE-NVVKNERLLKSYVDCLLEKGRCSPDGLELKKNMPDAIETDCSKCS 81 Query: 404 KKQ 412 +KQ Sbjct: 82 EKQ 84 >AM292343-1|CAL23155.2| 301|Tribolium castaneum gustatory receptor candidate 22 protein. Length = 301 Score = 21.0 bits (42), Expect = 9.3 Identities = 8/27 (29%), Positives = 15/27 (55%) Frame = -2 Query: 86 LSLVLKTAQLDFELVETAVQLGDVRAS 6 L+L+ Q FE++ + GDV ++ Sbjct: 105 LNLIFLLIQTRFEMINNIITRGDVTST 131 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 114,269 Number of Sequences: 336 Number of extensions: 1973 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17697850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -