BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0857 (730 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0099 + 20070925-20073867 32 0.54 07_03_1632 + 28271559-28271645,28272641-28272713,28273030-282733... 28 6.6 >11_06_0099 + 20070925-20073867 Length = 980 Score = 31.9 bits (69), Expect = 0.54 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = -1 Query: 415 ISQIRNLTCLLLQESLIHGNY*QCSVMSTTVFF 317 I +++NL L L +L+HG + QCS MS FF Sbjct: 599 ICELQNLHGLDLSNNLLHGEFPQCSGMSMMSFF 631 >07_03_1632 + 28271559-28271645,28272641-28272713,28273030-28273361, 28273455-28274791,28275451-28275848,28275963-28277644, 28277727-28277884,28278645-28278802,28279110-28279270, 28279826-28280014 Length = 1524 Score = 28.3 bits (60), Expect = 6.6 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 4/58 (6%) Frame = +2 Query: 8 SSSPGCCTKV*NTTEKRCTHGP---HLPAIPGSIS-PRANAQPIVRVPVLPLSNTLCC 169 S PG + +++ K H P +P S+S P ANA P++ PV+ + +CC Sbjct: 523 SDMPGTSKREISSSLKNDRHTPAEEQRMHVPPSVSAPTANAAPMLPAPVVIEEHWVCC 580 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,399,856 Number of Sequences: 37544 Number of extensions: 336283 Number of successful extensions: 717 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 706 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 717 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1909952136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -