BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0857 (730 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12802| Best HMM Match : Aldedh (HMM E-Value=0) 30 1.7 SB_6623| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 >SB_12802| Best HMM Match : Aldedh (HMM E-Value=0) Length = 880 Score = 30.3 bits (65), Expect = 1.7 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +1 Query: 1 VAIFLAGVLYEGLKYYREALHTR 69 +A+F+ VLYEGLK RE L R Sbjct: 132 IAVFILAVLYEGLKVSREMLKRR 154 >SB_6623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 27.9 bits (59), Expect = 8.9 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = -3 Query: 383 ATRITNTR*LLTVFCHVDHRVLLPSEEKVADRQTKDKGQTQP 258 AT + T+ L+ VF +V + PS+EKV + T+ QP Sbjct: 37 ATALFLTKLLMAVFINVHNLGKFPSKEKVPEASTQRNCYAQP 78 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,195,260 Number of Sequences: 59808 Number of extensions: 373890 Number of successful extensions: 783 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 737 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 782 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1949964354 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -